UniProt ID | GNR1_SCHPO | |
---|---|---|
UniProt AC | O59762 | |
Protein Name | Guanine nucleotide-binding protein negative regulator 1 | |
Gene Name | gnr1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 399 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Negatively regulates the pheromone-response pathway. Acts as a structural mimic of the G protein beta subunit thereby interacting with gpa1 which then inhibits gpa1 signaling.. | |
Protein Sequence | MDNCVNSFEDQKDDLVHKKKSQNFGYVCGSINLGTNVIAQSPTKPLNFFHSSRWSPDGSTILSLTEDQCLNCWNVPFSDLSKKADGPLNFSKHLSYKYQSPETVYSYSWYSRMKLDDPSSNLFAVSSRDQPIKLINFTTGKNKASYHMIDHQERYQGSHCLQFTNDGEYLIAGDKNCLHHFNIRTGCKEPVMTTVTHGYKVPLWEFSLKGIQSCFSLNPMDSKTLAVGTYSNRVGIYNDCGRRPCQLEFSIERGNGVTHLQWCEDGEKLYVGSRCSDKIEVWDIRYVRDMVYALEGHRGDTNQRILFDTDKKDEILAGGTDGSIRRWRNKDLVEETHVTGNYDLTVNTVQANPINMQIKCVCYGNRIYKYEKDESEEEDESKEKDLWTGTVSALQVWMD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of GNR1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GNR1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GNR1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GNR1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HRR1_SCHPO | hrr1 | genetic | 18818364 | |
PCK1_SCHPO | pck1 | genetic | 22681890 | |
RAV2_SCHPO | rav2 | genetic | 22681890 | |
ADK_SCHPO | ado1 | genetic | 22681890 | |
YAQD_SCHPO | SPAC18G6.13 | genetic | 22681890 | |
DSK1_SCHPO | dsk1 | genetic | 22681890 | |
RAF1_SCHPO | raf1 | genetic | 22681890 | |
PPK16_SCHPO | ppk16 | genetic | 22681890 | |
RS4B_SCHPO | rps402 | genetic | 22681890 | |
YCPE_SCHPO | trp663 | genetic | 22681890 | |
SPF31_SCHPO | spf31 | genetic | 22681890 | |
KCC1_SCHPO | cmk1 | genetic | 22681890 | |
CSK1_SCHPO | csk1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...