GBGT2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GBGT2_HUMAN
• UniProt AC: O14610
• Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
• Gene Name: GNGT2
• Organism: Homo sapiens (Human).
• Sequence Length: 69
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction..
• Protein Sequence: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
57	Ubiquitination	LKGIPEDKNPFKEKG HCCCCCCCCCCHHCC	65.93	-
66	Methylation	PFKEKGGCLIS---- CCHHCCCCCCC----	4.09	-
66	Farnesylation	PFKEKGGCLIS---- CCHHCCCCCCC----	4.09	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GBGT2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GBGT2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GBGT2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GBB2_HUMAN	GNB2	physical	8636150
GBB4_HUMAN	GNB4	physical	8636150
GBB1_HUMAN	GNB1	physical	8636150
GBB1_HUMAN	GNB1	physical	19168127
GBB2_HUMAN	GNB2	physical	19168127
GBB3_HUMAN	GNB3	physical	19168127

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.