| UniProt ID | GBG13_HUMAN | |
|---|---|---|
| UniProt AC | Q9P2W3 | |
| Protein Name | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 | |
| Gene Name | GNG13 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 67 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.. | |
| Protein Sequence | MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | Phosphorylation | AFQREMASKTIPELL HHHHHHHHHCHHHHH | 29.08 | - | |
| 30 | Phosphorylation | QREMASKTIPELLKW HHHHHHHCHHHHHHH | 38.99 | 24719451 | |
| 64 | Methylation | PWVEKGKCTIL---- CCCCCCCEEEC---- | 3.79 | - | |
| 64 | Farnesylation | PWVEKGKCTIL---- CCCCCCCEEEC---- | 3.79 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBG13_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBG13_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBG13_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GNAT3_HUMAN | GNAT3 | physical | 10570481 | |
| GBB4_HUMAN | GNB4 | physical | 10570481 | |
| GBB1_HUMAN | GNB1 | physical | 10570481 | |
| GNB5_HUMAN | GNB5 | physical | 11675383 | |
| GBB1_HUMAN | GNB1 | physical | 19168127 | |
| GBB3_HUMAN | GNB3 | physical | 19168127 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
