UniProt ID | GBG11_HUMAN | |
---|---|---|
UniProt AC | P61952 | |
Protein Name | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11 | |
Gene Name | GNG11 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 73 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.. | |
Protein Sequence | MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Ubiquitination | HIEDLPEKEKLKMEV CHHCCCHHHHHHHHH | 59.20 | - | |
14 | Ubiquitination | EDLPEKEKLKMEVEQ HCCCHHHHHHHHHHH | 65.56 | - | |
35 | Ubiquitination | LQRQQVSKCSEEIKN HHHHHHHHHHHHHHH | 42.81 | - | |
41 | Ubiquitination | SKCSEEIKNYIEERS HHHHHHHHHHHHHHH | 47.15 | - | |
55 | Ubiquitination | SGEDPLVKGIPEDKN HCCCCCCCCCCCCCC | 59.82 | - | |
61 | Ubiquitination | VKGIPEDKNPFKEKG CCCCCCCCCCCCCCC | 65.93 | - | |
70 | Methylation | PFKEKGSCVIS---- CCCCCCCCCCC---- | 4.25 | - | |
70 | Farnesylation | PFKEKGSCVIS---- CCCCCCCCCCC---- | 4.25 | 7665596 | |
70 | Farnesylation | PFKEKGSCVIS---- CCCCCCCCCCC---- | 4.25 | 7665596 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBG11_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBG11_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBG11_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AMOL2_HUMAN | AMOTL2 | physical | 16189514 | |
ZHX1_HUMAN | ZHX1 | physical | 16169070 | |
GBB1_HUMAN | GNB1 | physical | 19168127 | |
GBB3_HUMAN | GNB3 | physical | 19168127 | |
MEOX2_HUMAN | MEOX2 | physical | 25416956 | |
CEP44_HUMAN | CEP44 | physical | 25416956 | |
PHLP_HUMAN | PDCL | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Prenylation | |
Reference | PubMed |
"Isolation of cDNA clones encoding eight different human G proteingamma subunits, including three novel forms designated the gamma 4,gamma 10, and gamma 11 subunits."; Ray K., Kunsch C., Bonner L.M., Robishaw J.D.; J. Biol. Chem. 270:21765-21771(1995). Cited for: NUCLEOTIDE SEQUENCE [MRNA], AND ISOPRENYLATION AT CYS-70. |