UniProt ID | GATF_YEAST | |
---|---|---|
UniProt AC | P53260 | |
Protein Name | Glutamyl-tRNA(Gln) amidotransferase subunit F, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03151} | |
Gene Name | GTF1 {ECO:0000255|HAMAP-Rule:MF_03151} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 183 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side . |
|
Protein Description | Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln). Required for proper protein synthesis within the mitochondrion.. | |
Protein Sequence | MYKTWRLCRTHTVGGLCHDGSHRFVSTGGAKIGKKFENMNQIRDYLSRPVWSVHEYLGINTKEEKLEPPSAEAVKKLLRLSGLPLEGADIKEIQMRLAKQLSFINKLHNIPVEGEKHTKEYDARLVQRNTKQLNYTKLLEGISHQKQDAELGEVSGSWKATGLAAESKNAYFVVKEGLLKNRK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
159 | Ubiquitination | GEVSGSWKATGLAAE HCCCCCHHHCCCEEC | 37.45 | 17644757 | |
167 | Phosphorylation | ATGLAAESKNAYFVV HCCCEECCCCEEEEE | 26.87 | 28152593 | |
168 | Ubiquitination | TGLAAESKNAYFVVK CCCEECCCCEEEEEE | 36.78 | 17644757 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GATF_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GATF_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GATF_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GATB_YEAST | PET112 | genetic | 21799017 | |
GATA_YEAST | HER2 | genetic | 21799017 | |
SEC65_YEAST | SEC65 | genetic | 27708008 | |
TIM22_YEAST | TIM22 | genetic | 27708008 | |
TFB1_YEAST | TFB1 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
NU145_YEAST | NUP145 | genetic | 27708008 | |
CTF8_YEAST | CTF8 | genetic | 27708008 | |
CDC11_YEAST | CDC11 | genetic | 27708008 | |
MED14_YEAST | RGR1 | genetic | 27708008 | |
GSP1_YEAST | GSP1 | genetic | 27708008 | |
UTP15_YEAST | UTP15 | genetic | 27708008 | |
TIM23_YEAST | TIM23 | genetic | 27708008 | |
RPB2_YEAST | RPB2 | genetic | 27708008 | |
ORC4_YEAST | ORC4 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...