| UniProt ID | FUT9_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y231 | |
| Protein Name | Alpha-(1,3)-fucosyltransferase 9 | |
| Gene Name | FUT9 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 359 | |
| Subcellular Localization |
Golgi apparatus, Golgi stack membrane Single-pass type II membrane protein. Membrane-bound form in trans cisternae of Golgi.. |
|
| Protein Description | Transfers a fucose to lacto-N-neotetraose but not to either alpha2,3-sialyl lacto-N-neotetraose or lacto-N-tetraose. Can catalyze the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides.. | |
| Protein Sequence | MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 62 | N-linked_Glycosylation | STKTDYFNETTILVW CCCCCCCCCEEEEEE | 39.20 | UniProtKB CARBOHYD | |
| 101 | N-linked_Glycosylation | TTDRSLYNKSHAVLI ECCHHHCCCCCEEEE | 44.65 | UniProtKB CARBOHYD | |
| 142 | Phosphorylation | NLESPTHTPQKSGIE ECCCCCCCCCCCCCH | 29.87 | - | |
| 153 | N-linked_Glycosylation | SGIEHLFNLTLTYRR CCCHHHHEEEEEEEC | 38.18 | UniProtKB CARBOHYD | |
| 206 | Phosphorylation | EHARVKYYNELSKSI HHHHHHHHHHHHHCE | 9.10 | 22817900 | |
| 301 | Phosphorylation | SPSELAKYLKEVDKN CHHHHHHHHHHHCCC | 19.87 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FUT9_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FUT9_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FUT9_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TSSK3_HUMAN | TSSK3 | physical | 21988832 | |
| OS9_HUMAN | OS9 | physical | 26186194 | |
| LFA3_HUMAN | CD58 | physical | 26186194 | |
| FKB14_HUMAN | FKBP14 | physical | 26186194 | |
| LMF1_HUMAN | LMF1 | physical | 26186194 | |
| NECT2_HUMAN | PVRL2 | physical | 26186194 | |
| FKB14_HUMAN | FKBP14 | physical | 28514442 | |
| CALX_HUMAN | CANX | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
