| UniProt ID | FGF9_HUMAN | |
|---|---|---|
| UniProt AC | P31371 | |
| Protein Name | Fibroblast growth factor 9 | |
| Gene Name | FGF9 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 208 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.. | |
| Protein Sequence | MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 79 | N-linked_Glycosylation | FHLEIFPNGTIQGTR CEEEECCCCCEEECC | 49.87 | UniProtKB CARBOHYD | |
| 79 | N-linked_Glycosylation | FHLEIFPNGTIQGTR CEEEECCCCCEEECC | 49.87 | 11223514 | |
| 106 | Phosphorylation | SIAVGLVSIRGVDSG HHHHHCHHEECCCCC | 16.17 | 24719451 | |
| 163 | Phosphorylation | VDTGRRYYVALNKDG ECCCCEEEEEECCCC | 4.21 | - | |
| 176 | Phosphorylation | DGTPREGTRTKRHQK CCCCCCCCCCCCCCC | 30.34 | - | |
| 178 | Phosphorylation | TPREGTRTKRHQKFT CCCCCCCCCCCCCCC | 32.06 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FGF9_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FGF9_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FGF9_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FGF9_HUMAN | FGF9 | physical | 11223514 | |
| EIF2A_HUMAN | EIF2A | physical | 28514442 | |
| AFAD_HUMAN | MLLT4 | physical | 28514442 | |
| F10C1_HUMAN | FRA10AC1 | physical | 28514442 | |
| SPT4H_HUMAN | SUPT4H1 | physical | 28514442 | |
| T2FA_HUMAN | GTF2F1 | physical | 28514442 | |
| TMED7_HUMAN | TMED7 | physical | 28514442 | |
| NAA15_HUMAN | NAA15 | physical | 28514442 | |
| PPID_HUMAN | PPID | physical | 28514442 | |
| FGF20_HUMAN | FGF20 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 612961 | Multiple synostoses syndrome 3 (SYNS3) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
