dbPTM

ELBOW_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ELBOW_DROME
UniProt AC	Q9VJS8
Protein Name	Zinc finger protein Elbow
Gene Name	elB
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	553
Subcellular Localization
Protein Description	May negatively regulate Notch-induced cell proliferation in the eye-head primordium. May act in leg and wing primordia to negatively regulate body-wall specifying genes and thereby promote appendage formation. Required for tracheal development..
Protein Sequence	MLQSSNHHYLRPDYMTAAAAPTAQLDNKSSPLALLAQTCSAIGADTTNPKLLAANIEKSTKQLQHHPKGSSGSGGSGSFGLSQQASMDGSARDKSSPVSSHSSSVSTGSVEQQQLPPAHGSSSSSKPTPTTFKPYEPNNNISNITTAADCGATNLSSNNTSAQQRVKTPKSMTNGGGQRCDSNQSASSQHRESPTAAGSLRRTPTSGLAGGVMQHNGSPGLPPTASTTPGRSNSKESAAMHSPSAAAAAAAAAAQIASSNRLQEAALAAAKEANYVKALHAASQQGSASAAAAAASYYPPGYGSPYSMDLMTASSLMSPHHAMFKASAMNPYLNYARMKGLTEQSMMAATPNVCRDPYCTGCPASPHYINKAAGQPCPAGCPQCEGGGGGGGGSSKSSGSQGGSGGSSSAAAAAAAAAASSYHAQLAALAAASQMPYVCSWIGSDAAYCGKRFGTSDDLFQHLRTHTASVPDAVLSAAAAGGIPPNHPLFQRTYPTPPLSPLSAARYHPYGKPSMLPPSLAPPGMPGLPPHPALAQYFAPYSLYGPRMGSSHP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ELBOW_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ELBOW_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ELBOW_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ELBOW_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ACOX1_DROME	CG5009	physical	14605208
NANOS_DROME	nos	physical	14605208
JMJD4_DROME	CG7200	physical	14605208
CCNE_DROME	CycE	genetic	12242236
ELBOW_DROME	elB	physical	12117809
NOC_DROME	noc	physical	12117809
GROU_DROME	gro	physical	12117809

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ELBOW_DROME

Related Literatures of Post-Translational Modification