UniProt ID | ELBOW_DROME | |
---|---|---|
UniProt AC | Q9VJS8 | |
Protein Name | Zinc finger protein Elbow | |
Gene Name | elB | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 553 | |
Subcellular Localization | ||
Protein Description | May negatively regulate Notch-induced cell proliferation in the eye-head primordium. May act in leg and wing primordia to negatively regulate body-wall specifying genes and thereby promote appendage formation. Required for tracheal development.. | |
Protein Sequence | MLQSSNHHYLRPDYMTAAAAPTAQLDNKSSPLALLAQTCSAIGADTTNPKLLAANIEKSTKQLQHHPKGSSGSGGSGSFGLSQQASMDGSARDKSSPVSSHSSSVSTGSVEQQQLPPAHGSSSSSKPTPTTFKPYEPNNNISNITTAADCGATNLSSNNTSAQQRVKTPKSMTNGGGQRCDSNQSASSQHRESPTAAGSLRRTPTSGLAGGVMQHNGSPGLPPTASTTPGRSNSKESAAMHSPSAAAAAAAAAAQIASSNRLQEAALAAAKEANYVKALHAASQQGSASAAAAAASYYPPGYGSPYSMDLMTASSLMSPHHAMFKASAMNPYLNYARMKGLTEQSMMAATPNVCRDPYCTGCPASPHYINKAAGQPCPAGCPQCEGGGGGGGGSSKSSGSQGGSGGSSSAAAAAAAAAASSYHAQLAALAAASQMPYVCSWIGSDAAYCGKRFGTSDDLFQHLRTHTASVPDAVLSAAAAGGIPPNHPLFQRTYPTPPLSPLSAARYHPYGKPSMLPPSLAPPGMPGLPPHPALAQYFAPYSLYGPRMGSSHP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ELBOW_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ELBOW_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ELBOW_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ELBOW_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ACOX1_DROME | CG5009 | physical | 14605208 | |
NANOS_DROME | nos | physical | 14605208 | |
JMJD4_DROME | CG7200 | physical | 14605208 | |
CCNE_DROME | CycE | genetic | 12242236 | |
ELBOW_DROME | elB | physical | 12117809 | |
NOC_DROME | noc | physical | 12117809 | |
GROU_DROME | gro | physical | 12117809 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...