UniProt ID | NOC_DROME | |
---|---|---|
UniProt AC | Q24423 | |
Protein Name | Zinc finger protein Noc | |
Gene Name | noc | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 537 | |
Subcellular Localization | ||
Protein Description | May negatively regulate Notch-induced cell proliferation in the eye-head primordium. Required for development of the supraesophageal ganglion and ocelli. May act in leg and wing primordia to negatively regulate body-wall specifying genes and thereby promote appendage formation. Plays a role in tracheal development.. | |
Protein Sequence | MVVLEGGGGVVTIGNNQYLQPDYLAPLPTTMDAKKSPLALLAQTCSQIGADSSAVKPLLAMDKNKTKPGACSSSSNSSSSSGSAEISAAKSPSGQAKSPKSSTPISSTATSASLSNTSTGEIKLAFKPYETNVLSHQNQNSFKSSSSLDAEPTRPSSKNSSSAQERVPSRSKSNATPTDGGKAEISAHDSSSSRKTVSPSGSSQRGASPIVRSGMEVLNNANGTAQHPKEMSSMAAAAAAAAAAYKAAGPYGLNPLSALCCPPGMEQHANPAFRPPFAGGFSHHHAAMLAVAANGGYPGGAPGGGPAGQPNPYISYQRIKTPAGGEAIVPVCKDPYCQGCPYSAHTQQMLMGAPCPAGCTQCEHQKYGLAMASAAGLPPAHPYSQAAAAAAANAAAARSAPYVCSWVVGDAYCGKRFQTSDELFSHLRTHTGNLSDPAAAAAALAQSQAQSLLGTLFPPSALRAGYPTPPLSPMSAAAAAARYHPYAKPPPGALAGGPSPFGAAGAFNPAAAAAAAALGPYYSPYAMYGQRMGAAHQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
93 | Phosphorylation | ISAAKSPSGQAKSPK EEEECCCCCCCCCCC | 51.10 | 22817900 | |
98 | Phosphorylation | SPSGQAKSPKSSTPI CCCCCCCCCCCCCCC | 40.34 | 22817900 | |
156 | Phosphorylation | DAEPTRPSSKNSSSA CCCCCCCCCCCCCCH | 51.13 | 27794539 | |
157 | Phosphorylation | AEPTRPSSKNSSSAQ CCCCCCCCCCCCCHH | 38.24 | 22817900 | |
208 | Phosphorylation | GSSQRGASPIVRSGM CCCCCCCCCCHHHHH | 20.27 | 18327897 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NOC_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NOC_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NOC_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NOC_DROME | noc | physical | 14605208 | |
ELBOW_DROME | elB | physical | 12117809 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-98; SER-157 AND SER-208,AND MASS SPECTROMETRY. |