| UniProt ID | ECD_DROME | |
|---|---|---|
| UniProt AC | Q9W032 | |
| Protein Name | Protein ecdysoneless {ECO:0000305|PubMed:15128659} | |
| Gene Name | ecd {ECO:0000312|FlyBase:FBgn0000543} | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 684 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Required in both the follicle cells and the germline for oocyte development.. | |
| Protein Sequence | MSKIPGSNLEFVREEDFVEYYIFPKIPDNVQDEGALRKLMLQIRNEISAIVREKSLERSYLWHKDEFQLQVRLGGAEERLLNEETNPEEEAELGDLPPHFHGVTHYGDNISDEWFVVYLLTEITRARGDCIARVSDSDGEFLLIEAADALPDWASPETCEQRVYLVGGHLQLLQNSAASSQDKPLTMAMAVQRIRMNPTLYRCSQEIQSCIDARLKEYQIAQPHFSIHRQVLELPHSAAQLLKQKPRLLSSAVRAFCERDSLDIKALRTMRYFPPEATRVRTNVRFTRCLYAMLSHQQYLPEKRLGWHLTDPVSEPERYKEQLLGLKLASGLEILATQAKRVEGQQLEDLPAWRSYLRSLLSKGYFRDNIEGSAEYQELLNKAKVYFRGNQERFRTASRAGAEILDLLLHPAEAASEELRDEENNLQPSDSDEWLNISAEDLDSMLQDRYGPKKLYKPNGQMNAEEFTKQLAEFLDRQSNYEGIEHRGLEEPELDSDDDEPPPQANGSTGLTAKVKKNPSMRKACQRNSVIQPEEPDSTHVRNFLDFVIPEDNWDSTSEMSDYADEDDMESNLNALSGGGSVFPLDRQIQSYMEQMDRELAQTSVGKSFHGKKKTAPQADEDDFDDIEDFEPININVNTLRNMMDSYQSQVGGAGPVSNLFSAMGVGMSAVEDKEQKDISESAV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ECD_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ECD_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ECD_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| U520_DROME | l(3)72Ab | physical | 22036573 | |
| CD2B2_DROME | holn1 | physical | 22036573 | |
| F10A1_DROME | HIP-R | physical | 22036573 | |
| F10A2_DROME | HIP-R | physical | 22036573 | |
| RAS1_DROME | Ras85D | genetic | 24722212 | |
| U520_DROME | l(3)72Ab | physical | 24722212 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...