DICH_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DICH_DROME
• UniProt AC: Q24533
• Protein Name: SOX domain-containing protein dichaete
• Gene Name: D
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 382
• Subcellular Localization: Nucleus .
• Protein Description: Essential for segmentation and CNS development. May modulate the actions of other transcription factors, including gap and pair-rule proteins..
• Protein Sequence: MATLSTHPNYGFHLGQAQGLEDYAPQSQLQLSPGMDMDIKRVLHYSQSLAAMGGSPNGPAGQGVNGSSGMGHHMSSHMTPHHMHQAVSAQQTLSPNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGPQGGLQMQAGGMGQQKLGAGPGAGAGGYNPFHQLPPYFAPSHHLDQGYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQAPPQLPPTSLSSFYSGIYSGISAPSLYAAHSANAAGLYPSSSTSSPGSSPGTITPNGMDGSMDSALRRPVPVLY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of DICH_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DICH_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DICH_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DICH_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DECA_DROME	dpp	genetic	10753518
CF1A_DROME	vvl	genetic	9735360
SIM_DROME	sim	genetic	10844029
TTKB_DROME	ttk	physical	23935523
TTKA_DROME	ttk	physical	23935523

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.