dbPTM

CF1A_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CF1A_DROME
UniProt AC	P16241
Protein Name	POU domain protein CF1A
Gene Name	vvl
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	427
Subcellular Localization	Nucleus.
Protein Description	Binds to a DNA sequence element required for the expression of the dopa decarboxylase gene (Ddc) in specific dopaminergic neurons. Could also play an early role in specific ectodermal cells, and a subsequent role in the embryonic nervous system..
Protein Sequence	MAATSYMTPPSGDLDMALGGGGYHTSSPRSAADAGEMKYMQHHHHHHAAAAAAAHHQLPSSPSPNGQGNGGGLGLGSGSGLGSWSALHPDPWMQTHHTHHLPAAAAVASAADTVKQEMSHLSQQTRIQQGMASPHAAWHAPHAGHYAPTGGSPLQYHHAMNGMLHHPAHAVAAAHHQSVAPLHHTLRGESPQLHIHHHMGGGDRDAISGGEEDTPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMPPGHMHHGGYHPHHDMHGSPMGTHSHSHSPPMLSPQNMQSSAVAAHQLAAH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
190	Phosphorylation	HHTLRGESPQLHIHH CCHHCCCCCCEEEEC	22.29	18327897
291	Phosphorylation	EADSTTGSPTSIDKI HHHCCCCCCCHHHHH	23.94	27794539

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CF1A_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CF1A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CF1A_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IPOU_DROME	acj6	physical	1673230
EGFR_DROME	Egfr	genetic	1980740
DICH_DROME	D	genetic	9735360
CF1A_DROME	vvl	physical	1673230
SRP09_DROME	Srp9	physical	25242320
IPOU_DROME	acj6	physical	1346754

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CF1A_DROME

Related Literatures of Post-Translational Modification