DI197_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DI197_ARATH
• UniProt AC: Q9FJ17
• Protein Name: Protein DEHYDRATION-INDUCED 19 homolog 7
• Gene Name: DI19-7
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 211
• Subcellular Localization: Nucleus .
• Protein Description: Involved in both red and blue light signaling..
• Protein Sequence: MDSNSWINCPPVFSSSPSSRRYQSRSDLYLGDVEGEDDLKAEFMCPFCADEFDIVGLCCHIDVNHPVEAKNGVCPVCTKKVGLDIVGHITTQHGNVFKVQRRRRLRKGGYSSTYLTLKKELREANLQSLGGSSTFIPSSNIDSDPLLSSFMFKPPSAIPITEGDSVAQVSPKDTSKSKIQQESFSNEDQEKAKKSKFVRGLLWSTMLEDKF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
113	Phosphorylation	RKGGYSSTYLTLKKE HHCCCCHHHHHHHHH	19.33	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DI197_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DI197_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DI197_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PIF4_ARATH	PIF4	genetic	17916114
FT_ARATH	FT	genetic	17916114
PHYB_ARATH	PHYB	genetic	17916114
CRY2_ARATH	CRY2	genetic	17916114
PPP7_ARATH	PP7	physical	22589732

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.