UniProt ID | DI197_ARATH | |
---|---|---|
UniProt AC | Q9FJ17 | |
Protein Name | Protein DEHYDRATION-INDUCED 19 homolog 7 | |
Gene Name | DI19-7 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 211 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in both red and blue light signaling.. | |
Protein Sequence | MDSNSWINCPPVFSSSPSSRRYQSRSDLYLGDVEGEDDLKAEFMCPFCADEFDIVGLCCHIDVNHPVEAKNGVCPVCTKKVGLDIVGHITTQHGNVFKVQRRRRLRKGGYSSTYLTLKKELREANLQSLGGSSTFIPSSNIDSDPLLSSFMFKPPSAIPITEGDSVAQVSPKDTSKSKIQQESFSNEDQEKAKKSKFVRGLLWSTMLEDKF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
113 | Phosphorylation | RKGGYSSTYLTLKKE HHCCCCHHHHHHHHH | 19.33 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DI197_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DI197_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DI197_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PIF4_ARATH | PIF4 | genetic | 17916114 | |
FT_ARATH | FT | genetic | 17916114 | |
PHYB_ARATH | PHYB | genetic | 17916114 | |
CRY2_ARATH | CRY2 | genetic | 17916114 | |
PPP7_ARATH | PP7 | physical | 22589732 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...