DHDDS_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DHDDS_HUMAN
• UniProt AC: Q86SQ9
• Protein Name: Dehydrodolichyl diphosphate synthase complex subunit DHDDS {ECO:0000305}
• Gene Name: DHDDS
• Organism: Homo sapiens (Human).
• Sequence Length: 333
• Subcellular Localization: Endoplasmic reticulum membrane ; Peripheral membrane protein . colocalizes with calnexin.
• Protein Description: With DHDDS, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol..
• Protein Sequence: MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSWIKEGEL ------CCCCCCCCC	37.19	29759185
5 (in isoform 2)	Ubiquitination	-	54.10	-
5	Ubiquitination	---MSWIKEGELSLW ---CCCCCCCCCCHH	54.10	-
10	Phosphorylation	WIKEGELSLWERFCA CCCCCCCCHHHHHHH	27.43	29759185
20	Ubiquitination	ERFCANIIKAGPMPK HHHHHHHHHHCCCCC	2.22	29967540
21	Ubiquitination	RFCANIIKAGPMPKH HHHHHHHHHCCCCCE	43.42	29967540
86	Phosphorylation	SIENFKRSKSEVDGL HHHHHCCCHHHHCHH	40.92	26471730
87 (in isoform 3)	Ubiquitination	-	55.45	21906983
87 (in isoform 1)	Ubiquitination	-	55.45	21906983
87 (in isoform 2)	Ubiquitination	-	55.45	21906983
87	Ubiquitination	IENFKRSKSEVDGLM HHHHCCCHHHHCHHH	55.45	21906983
88	Phosphorylation	ENFKRSKSEVDGLMD HHHCCCHHHHCHHHH	44.06	22210691
102	Phosphorylation	DLARQKFSRLMEEKE HHHHHHHHHHHHHHH	31.38	28102081
113 (in isoform 2)	Ubiquitination	-	53.41	-
113	Ubiquitination	EEKEKLQKHGVCIRV HHHHHHHHHCCEEEE	53.41	29967540
157	Phosphorylation	LNVCFAYTSRHEISN HHHHHHHHCHHHHHH	18.82	-
158	Phosphorylation	NVCFAYTSRHEISNA HHHHHHHCHHHHHHH	20.97	-
163	Phosphorylation	YTSRHEISNAVREMA HHCHHHHHHHHHHHH	18.76	21406692
193	Ubiquitination	SLLDKCLYTNRSPHP HHHHHHHHCCCCCCC	16.07	21963094
208	Ubiquitination	DILIRTSGEVRLSDF CEEEECCCCEEHHHH	36.48	29967540
227	Ubiquitination	TSHSCLVFQPVLWPE CCCCEEEECCCCCCH	4.36	21963094
228	Ubiquitination	SHSCLVFQPVLWPEY CCCEEEECCCCCCHH	21.51	21963094
262	Ubiquitination	QKARDMYAEERKRQQ HHHHHHHHHHHHHHH	12.92	29967540
267	Ubiquitination	MYAEERKRQQLERDQ HHHHHHHHHHHHHHH	35.38	29967540
281	Ubiquitination	QATVTEQLLREGLQA HHHHHHHHHHHHHHH	3.86	21963094
281 (in isoform 3)	Ubiquitination	-	3.86	21906983
286	Ubiquitination	EQLLREGLQASGDAQ HHHHHHHHHHCCCHH	3.09	21963094
287	Ubiquitination	QLLREGLQASGDAQL HHHHHHHHHCCCHHH	44.32	21963094
301	Ubiquitination	LRRTRLHKLSARREE HHHHHHHHHHHHHHH	49.05	29967540
302	Ubiquitination	RRTRLHKLSARREER HHHHHHHHHHHHHHH	3.18	29967540
303	Phosphorylation	RTRLHKLSARREERV HHHHHHHHHHHHHHH	25.24	24719451
304	Phosphorylation	TRLHKLSARREERVQ HHHHHHHHHHHHHHH	25.61	24719451
320 (in isoform 1)	Ubiquitination	-	35.84	21906983
320	Ubiquitination	FLQALELKRADWLAR HHHHHHHHHHHHHHH	35.84	21963094
321	Ubiquitination	LQALELKRADWLARL HHHHHHHHHHHHHHH	50.86	21963094
321 (in isoform 2)	Ubiquitination	-	50.86	21906983

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DHDDS_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DHDDS_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DHDDS_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LYOX_HUMAN	LOX	physical	15110773
NPC2_HUMAN	NPC2	physical	15110773
NU1M_HUMAN	ND1	physical	15110773
NGBR_HUMAN	NUS1	physical	26186194
FOXP4_HUMAN	FOXP4	physical	26186194
NGBR_HUMAN	NUS1	physical	28514442
FOXP4_HUMAN	FOXP4	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 613861: Retinitis pigmentosa 59 (RP59)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.