DB121_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DB121_HUMAN
• UniProt AC: Q5J5C9
• Protein Name: Beta-defensin 121
• Gene Name: DEFB121
• Organism: Homo sapiens (Human).
• Sequence Length: 76
• Subcellular Localization: Secreted .
• Protein Description: Has antibacterial activity..
• Protein Sequence: MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	TLLLAQVTPVMKCWG HHHHHHHCHHHHHCC	9.70	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DB121_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DB121_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DB121_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TC1D2_HUMAN	TCTEX1D2	physical	28514442
VWDE_HUMAN	VWDE	physical	28514442
CPSM_HUMAN	CPS1	physical	28514442
CO6A2_HUMAN	COL6A2	physical	28514442
MKS3_HUMAN	TMEM67	physical	28514442
OS9_HUMAN	OS9	physical	28514442
NHLC3_HUMAN	NHLRC3	physical	28514442
FSTL1_HUMAN	FSTL1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.