UniProt ID | DB121_HUMAN | |
---|---|---|
UniProt AC | Q5J5C9 | |
Protein Name | Beta-defensin 121 | |
Gene Name | DEFB121 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 76 | |
Subcellular Localization | Secreted . | |
Protein Description | Has antibacterial activity.. | |
Protein Sequence | MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Phosphorylation | TLLLAQVTPVMKCWG HHHHHHHCHHHHHCC | 9.70 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DB121_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DB121_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DB121_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TC1D2_HUMAN | TCTEX1D2 | physical | 28514442 | |
VWDE_HUMAN | VWDE | physical | 28514442 | |
CPSM_HUMAN | CPS1 | physical | 28514442 | |
CO6A2_HUMAN | COL6A2 | physical | 28514442 | |
MKS3_HUMAN | TMEM67 | physical | 28514442 | |
OS9_HUMAN | OS9 | physical | 28514442 | |
NHLC3_HUMAN | NHLRC3 | physical | 28514442 | |
FSTL1_HUMAN | FSTL1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...