CX6A2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CX6A2_HUMAN
• UniProt AC: Q02221
• Protein Name: Cytochrome c oxidase subunit 6A2, mitochondrial
• Gene Name: COX6A2
• Organism: Homo sapiens (Human).
• Sequence Length: 97
• Subcellular Localization: Mitochondrion inner membrane.
• Protein Description: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport..
• Protein Sequence: MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
69	Phosphorylation	YQHLRIRTKPYPWGD CCCEEEECCCCCCCC	33.72	26437602
85	Phosphorylation	NHTLFHNSHVNPLPT CCCCCCCCCCCCCCC	21.90	26437602

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CX6A2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CX6A2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CX6A2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
SNX21_HUMAN	SNX21	physical	21988832
RM12_HUMAN	MRPL12	physical	21988832
POTE1_HUMAN	POT1	physical	21988832

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.