CRPM1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CRPM1_ARATH
• UniProt AC: Q9XIM7
• Protein Name: Cold-regulated 413 plasma membrane protein 1
• Gene Name: COR413PM1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 197
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MPMKSLRNDHGTLKAMIGSDFNELTIAAKNLATHAFTLTGLGFGTSVLEWVASIAAIYLLVLDRTNWKTNMLTSLLIPYIFFSLPSLIFGIFRGEIGKWIAFVAVVVQLFFPKHAREYLELPVALVLLAVVAPNLIAGTFRDSWIGLAICLGIGCYLLQEHIRASGGFRNAFTKANGISNTVGIICLVVFPVWALIF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CRPM1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CRPM1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CRPM1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CRPM1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CIPKE_ARATH	SR1	physical	24823379
HHP4_ARATH	HHP4	physical	24833385
UBC34_ARATH	UBC34	physical	24833385
ACBP6_ARATH	ACBP6	physical	24833385
CNIH1_ARATH	AT3G12180	physical	24833385
CP21D_ARATH	AT3G66654	physical	24833385
BET12_ARATH	ATBET12	physical	24833385
MMGT_ARATH	AT5G03345	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.