UniProt ID | CORO_SCHPO | |
---|---|---|
UniProt AC | O13923 | |
Protein Name | Coronin-like protein crn1 | |
Gene Name | crn1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 601 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSGRFVRASKYRHIFGQTCKKELCYDNIKLSNNAWDSNLLSVNPFYLSVNWNAGAGGALAVIPLNERGKLPDQVNLFRGHTAAVLDTDWNPFHDQVLASGGDDSKIMIWKVPEDYTVMEPYEDVHPIAELKGHSRKVGLVQYHPTAANVLASSSADNTIKLWDCEKGVAHVSLKMDVMCQSMSFNADGTRLVTTSRDKKVRVWDPRTDKPVSVGNGHAGAKNPRVVWLGSLDRFATTGFSKMSDRQIALWDPTNLSEPIGGFTTLDTGSGILMPFWDDGTKVIYLAGKGDGNIRYYEYENDVFHYLSEFKSVDPQRGIAFLPKRGVNVSENEVMRAYKSVNDSIIEPISFIVPRRSESFQSDIYPPAPSGKPSLTAEEWASGKDAQPDLLDMSTLYESKGTVEKAVSATVPSAGAQVQKHNEEKVETPKPEAQPVSKPKESAEEQKPSKEPEVKPTTPSASKVEEPSKKRDEDNHQKEETVTQPKREKTPVEKSFPKPASSPVTFSEDVKKEPSEEKKLEVSDEAPKAAPLAESKKVEEKEPFYVSKDKKDISAVNLADLNKRFEGFEKRYEEELAIRDWKIAQLEDKLAKLTEAIKEKCN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
115 | Phosphorylation | IWKVPEDYTVMEPYE EEECCCCCEECCCCC | 10.28 | 25720772 | |
116 | Phosphorylation | WKVPEDYTVMEPYED EECCCCCEECCCCCC | 26.21 | 25720772 | |
343 | Phosphorylation | AYKSVNDSIIEPISF HHHCCCCCCCCEEEE | 21.91 | 25720772 | |
427 | Phosphorylation | HNEEKVETPKPEAQP CCHHCCCCCCCCCCC | 39.33 | 28889911 | |
457 | Phosphorylation | EPEVKPTTPSASKVE CCCCCCCCCCHHHCC | 24.63 | 28889911 | |
494 | Phosphorylation | EKTPVEKSFPKPASS CCCCCHHCCCCCCCC | 33.02 | 28889911 | |
500 | Phosphorylation | KSFPKPASSPVTFSE HCCCCCCCCCCCCCH | 43.64 | 28889911 | |
501 | Phosphorylation | SFPKPASSPVTFSED CCCCCCCCCCCCCHH | 26.04 | 28889911 | |
504 | Phosphorylation | KPASSPVTFSEDVKK CCCCCCCCCCHHHCC | 25.48 | 24763107 | |
553 | Phosphorylation | SKDKKDISAVNLADL CCCHHHCCCCCHHHH | 35.98 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CORO_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CORO_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CORO_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EHS1_SCHPO | yam8 | genetic | 18931302 | |
CAPZA_SCHPO | acp1 | genetic | 18931302 | |
YAI8_SCHPO | SPAC24B11.08c | genetic | 18818364 | |
EME1_SCHPO | eme1 | genetic | 18818364 | |
UFD2_SCHPO | ufd2 | genetic | 22681890 | |
CAPZA_SCHPO | acp1 | genetic | 22681890 | |
CAPZB_SCHPO | acp2 | genetic | 22681890 | |
GMA12_SCHPO | gma12 | genetic | 22681890 | |
CTK3_SCHPO | lsg1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...