UniProt ID | CLE26_ARATH | |
---|---|---|
UniProt AC | O04547 | |
Protein Name | CLAVATA3/ESR (CLE)-related protein 26 | |
Gene Name | CLE26 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 118 | |
Subcellular Localization | Secreted, extracellular space. | |
Protein Description | Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.. | |
Protein Sequence | MRNNHSLRLQLWFRTLFTVGVVTLLMIDAFVLQNNKEDDKTKEITTAVNMNNSDAKEIQQELEDGSRNDDLSYVASKRKVPRGPDPIHNRFLLLSRFILSLLTNPYPYLHICVLDVSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
51 | N-linked_Glycosylation | ITTAVNMNNSDAKEI HHHHHHCCCCCHHHH | 39.38 | - | |
81 | Hydroxylation | VASKRKVPRGPDPIH HHHCCCCCCCCCCHH | 38.25 | - | |
84 | Hydroxylation | KRKVPRGPDPIHNRF CCCCCCCCCCHHHHH | 45.55 | - | |
84 | O-linked_Glycosylation | KRKVPRGPDPIHNRF CCCCCCCCCCHHHHH | 45.55 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLE26_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
84 | P | Glycosylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLE26_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HHP2_ARATH | HHP2 | physical | 24833385 | |
HHP4_ARATH | HHP4 | physical | 24833385 | |
UBC34_ARATH | UBC34 | physical | 24833385 | |
AB12I_ARATH | AT3G21580 | physical | 24833385 | |
CNIH1_ARATH | AT3G12180 | physical | 24833385 | |
CP21D_ARATH | AT3G66654 | physical | 24833385 | |
WAK3_ARATH | WAK3 | physical | 24833385 | |
PAM74_ARATH | AT5G59650 | physical | 24833385 | |
BETL2_ARATH | AT1G29060 | physical | 24833385 | |
BET12_ARATH | ATBET12 | physical | 24833385 | |
TBL18_ARATH | TBL18 | physical | 24833385 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...