| UniProt ID | CIPKI_ARATH | |
|---|---|---|
| UniProt AC | Q9LP51 | |
| Protein Name | CBL-interacting serine/threonine-protein kinase 18 | |
| Gene Name | CIPK18 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 520 | |
| Subcellular Localization | ||
| Protein Description | CIPK serine-threonine protein kinases interact with CBL proteins. Binding of a CBL protein to the regulatory NAF domain of CIPK protein lead to the activation of the kinase in a calcium-dependent manner (By similarity).. | |
| Protein Sequence | MAQALAQPPLVVTTVVPDPPPPPPPPHPKPYALRYMADLLGRIGIMDTDKDGNISPQSPRSPRSPRNNILMGKYELGKLLGHGTFAKVYLAQNIKSGDKVAIKVIDKEKIMKSGLVAHIKREISILRRVRHPYIVHLFEVMATKSKIYFVMEYVGGGELFNTVAKGRLPEETARRYFQQLISSVSFCHGRGVYHRDLKPENLLLDNKGNLKVSDFGLSAVAEQLRQDGLCHTFCGTPAYIAPEVLTRKGYDAAKADVWSCGVILFVLMAGHIPFYDKNIMVMYKKIYKGEFRCPRWFSSDLVRLLTRLLDTNPDTRITIPEIMKNRWFKKGFKHVKFYIEDDKLCREDEDEEEEASSSGRSSTVSESDAEFDVKRMGIGSMPRPSSLNAFDIISFSSGFDLSGLFEEEGGEGTRFVSGAPVSKIISKLEEIAKIVSFTVRKKEWSLRLEGCREGAKGPLTIAAEIFELTPSLVVVEVKKKGGDREEYEEFCNKELRPELEKLIHEEVVVEEALYLPSDTE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CIPKI_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CIPKI_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CIPKI_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CNBL2_ARATH | CBL2 | physical | 14730130 | |
| CNBL3_ARATH | CBL3 | physical | 14730130 | |
| CNBL4_ARATH | SOS3 | physical | 24970010 | |
| CNBL4_ORYSJ | Os05g0534400 | physical | 24970010 | |
| CNBL5_ORYSJ | Os01g0598200 | physical | 24970010 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...