UniProt ID | CIPKI_ARATH | |
---|---|---|
UniProt AC | Q9LP51 | |
Protein Name | CBL-interacting serine/threonine-protein kinase 18 | |
Gene Name | CIPK18 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 520 | |
Subcellular Localization | ||
Protein Description | CIPK serine-threonine protein kinases interact with CBL proteins. Binding of a CBL protein to the regulatory NAF domain of CIPK protein lead to the activation of the kinase in a calcium-dependent manner (By similarity).. | |
Protein Sequence | MAQALAQPPLVVTTVVPDPPPPPPPPHPKPYALRYMADLLGRIGIMDTDKDGNISPQSPRSPRSPRNNILMGKYELGKLLGHGTFAKVYLAQNIKSGDKVAIKVIDKEKIMKSGLVAHIKREISILRRVRHPYIVHLFEVMATKSKIYFVMEYVGGGELFNTVAKGRLPEETARRYFQQLISSVSFCHGRGVYHRDLKPENLLLDNKGNLKVSDFGLSAVAEQLRQDGLCHTFCGTPAYIAPEVLTRKGYDAAKADVWSCGVILFVLMAGHIPFYDKNIMVMYKKIYKGEFRCPRWFSSDLVRLLTRLLDTNPDTRITIPEIMKNRWFKKGFKHVKFYIEDDKLCREDEDEEEEASSSGRSSTVSESDAEFDVKRMGIGSMPRPSSLNAFDIISFSSGFDLSGLFEEEGGEGTRFVSGAPVSKIISKLEEIAKIVSFTVRKKEWSLRLEGCREGAKGPLTIAAEIFELTPSLVVVEVKKKGGDREEYEEFCNKELRPELEKLIHEEVVVEEALYLPSDTE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CIPKI_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CIPKI_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CIPKI_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CNBL2_ARATH | CBL2 | physical | 14730130 | |
CNBL3_ARATH | CBL3 | physical | 14730130 | |
CNBL4_ARATH | SOS3 | physical | 24970010 | |
CNBL4_ORYSJ | Os05g0534400 | physical | 24970010 | |
CNBL5_ORYSJ | Os01g0598200 | physical | 24970010 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...