CNBL4_ORYSJ - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CNBL4_ORYSJ
• UniProt AC: Q75KU4
• Protein Name: Calcineurin B-like protein 4
• Gene Name: CBL4
• Organism: Oryza sativa subsp. japonica (Rice).
• Sequence Length: 210
• Subcellular Localization: Cell membrane ; Lipid-anchor . Aleurone cells.
• Protein Description: Acts as a calcium sensor involved in the regulatory pathway for the control of intracellular Na(+) and K(+) homeostasis and salt tolerance. Operates in synergy with CIPK24 to activate the plasma membrane Na(+)/H(+) antiporter SOS1. May function as positive regulator of salt stress responses. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner..
• Protein Sequence: MGCASSKQFKRPPGYEEPAVLAAQTTFTVNEVEALRELYNKMSYSIIKDGLIHKEEFQLALFRNSRKANLFADRVFDLFDLKRNGVIEFGEFVRSLSVFHPKAPKSEKTAFAFKLYDLRGTGYIEKEELREMVLALLDESDLHLSECAVEAIVDNTFSQADSNGDGRIDPEEWEEFVKANPASLRNMSLPYLQDITMAFPSFVMHSEAHD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGCASSKQF ------CCCCCCCCC	18.72	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CNBL4_ORYSJ !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CNBL4_ORYSJ !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CNBL4_ORYSJ !!

Protein-Protein Interaction

Oops, there are no PPI records of CNBL4_ORYSJ !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.