UniProt ID | CNBL4_ORYSJ | |
---|---|---|
UniProt AC | Q75KU4 | |
Protein Name | Calcineurin B-like protein 4 | |
Gene Name | CBL4 | |
Organism | Oryza sativa subsp. japonica (Rice). | |
Sequence Length | 210 | |
Subcellular Localization |
Cell membrane Lipid-anchor . Aleurone cells. |
|
Protein Description | Acts as a calcium sensor involved in the regulatory pathway for the control of intracellular Na(+) and K(+) homeostasis and salt tolerance. Operates in synergy with CIPK24 to activate the plasma membrane Na(+)/H(+) antiporter SOS1. May function as positive regulator of salt stress responses. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner.. | |
Protein Sequence | MGCASSKQFKRPPGYEEPAVLAAQTTFTVNEVEALRELYNKMSYSIIKDGLIHKEEFQLALFRNSRKANLFADRVFDLFDLKRNGVIEFGEFVRSLSVFHPKAPKSEKTAFAFKLYDLRGTGYIEKEELREMVLALLDESDLHLSECAVEAIVDNTFSQADSNGDGRIDPEEWEEFVKANPASLRNMSLPYLQDITMAFPSFVMHSEAHD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGCASSKQF ------CCCCCCCCC | 18.72 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CNBL4_ORYSJ !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNBL4_ORYSJ !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNBL4_ORYSJ !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CNBL4_ORYSJ !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...