CBPN_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CBPN_HUMAN
• UniProt AC: P15169
• Protein Name: Carboxypeptidase N catalytic chain
• Gene Name: CPN1
• Organism: Homo sapiens (Human).
• Sequence Length: 458
• Subcellular Localization: Secreted, extracellular space.
• Protein Description: Protects the body from potent vasoactive and inflammatory peptides containing C-terminal Arg or Lys (such as kinins or anaphylatoxins) which are released into the circulation..
• Protein Sequence: MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
81	Phosphorylation	PLEPEVKYVGNMHGN CCCCCCEEECCCCCC	20.83	22817900
212	Phosphorylation	HSFNFVLSANLHGGA HHCCEEEEEEECCCE	15.15	21214269
224	Phosphorylation	GGAVVANYPYDKSFE CCEEEECCCCCCCHH	8.07	29116813
226	Phosphorylation	AVVANYPYDKSFEHR EEEECCCCCCCHHHH	26.16	21214269
400	O-linked_Glycosylation	GYDPETVTVTVGPAE CCCCCCEEEEECCCC	20.20	17157876
402	O-linked_Glycosylation	DPETVTVTVGPAEPT CCCCEEEEECCCCCC	15.47	17157876
409	O-linked_Glycosylation	TVGPAEPTLVNFHLK EECCCCCCEEEEEEC	34.54	17157876

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CBPN_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CBPN_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CBPN_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CO3_HUMAN	C3	physical	11939578
BTBD1_HUMAN	BTBD1	physical	28514442
CE170_HUMAN	CEP170	physical	28514442
KDM3B_HUMAN	KDM3B	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 212070: Carboxypeptidase N deficiency (CPND)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.