CAV3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CAV3_MOUSE
• UniProt AC: P51637
• Protein Name: Caveolin-3 {ECO:0000312|MGI:MGI:107570}
• Gene Name: Cav3 {ECO:0000312|MGI:MGI:107570}
• Organism: Mus musculus (Mouse).
• Sequence Length: 151
• Subcellular Localization: Golgi apparatus membrane; Peripheral membrane protein. Cell membrane ; Peripheral membrane protein. Membrane, caveola ; Peripheral membrane protein. Cell membrane, sarcolemma . Potential hairpin-like structure in the membrane. Membrane protein of cav
• Protein Description: May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. May also regulate voltage-gated potassium channels. Plays a role in the sarcolemma repair mechanism of both skeletal muscle and cardiomyocytes that permits rapid resealing of membranes disrupted by mechanical stress. [PubMed: 19380584 Mediates the recruitment of CAVIN2 and CAVIN3 proteins to the caveolae (By similarity]
• Protein Sequence: MMTEEHTDLEARIIKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKVSFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSNIKVVLRREG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Ubiquitination	DLEARIIKDIHCKEI HHHHHHHHHHCCCEE	48.54	22790023
19	S-nitrosocysteine	RIIKDIHCKEIDLVN HHHHHHCCCEEECCC	4.29	-
19	S-nitrosylation	RIIKDIHCKEIDLVN HHHHHHCCCEEECCC	4.29	21278135
30	Ubiquitination	DLVNRDPKNINEDIV ECCCCCCCCCCCCCE	74.81	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CAV3_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CAV3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CAV3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GBB1_MOUSE	Gnb1	physical	8663016
SRC_MOUSE	Src	physical	8663016
DMD_MOUSE	Dmd	physical	8663016
SGCA_MOUSE	Sgca	physical	8663016
DAG1_MOUSE	Dag1	physical	8663016
FLOT1_MOUSE	Flot1	physical	16455755

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.