UniProt ID | SGCA_MOUSE | |
---|---|---|
UniProt AC | P82350 | |
Protein Name | Alpha-sarcoglycan | |
Gene Name | Sgca | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 387 | |
Subcellular Localization |
Cell membrane, sarcolemma Single-pass type I membrane protein . Cytoplasm, cytoskeleton . |
|
Protein Description | Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.. | |
Protein Sequence | MAAAVTWIPLLAGLLAGLRDTKAQQTTLHLLVGRVFVHPLEHATFLRLPEHVAVPPTVRLTYHAHLQGHPDLPRWLHYTQRSPYNPGFLYGSPTPEDRGYQVIEVTAYNRDSFDTTRQRLLLLIGDPEGPRLPYQAEFLVRSHDVEEVLPTTPANRFLTALGGLWEPGELQLLNITSALDRGGRVPLPIEGRKEGVYIKVGSATPFSTCLKMVASPDSYARCAQGQPPLLSCYDTLAPHFRVDWCNVSLVDKSVPEPLDEVPTPGDGILEHDPFFCPPTEATDRDFLTDALVTLLVPLLVALLLTLLLAYIMCFRREGRLKRDMATSDIQMFHHCSIHGNTEELRQMAASREVPRPLSTLPMFNVRTGERLPPRVDSAQMPLILDQH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
151 | Phosphorylation | DVEEVLPTTPANRFL CHHHHCCCCCHHHHH | 41.05 | 27742792 | |
152 | Phosphorylation | VEEVLPTTPANRFLT HHHHCCCCCHHHHHH | 20.61 | 27742792 | |
174 | N-linked_Glycosylation | PGELQLLNITSALDR CCCEEEEEHHHCCCC | 44.05 | - | |
202 | Phosphorylation | GVYIKVGSATPFSTC CEEEEECCCCCHHHH | 31.77 | 25266776 | |
204 | Phosphorylation | YIKVGSATPFSTCLK EEEECCCCCHHHHHH | 26.94 | 25266776 | |
246 | N-linked_Glycosylation | HFRVDWCNVSLVDKS CCEEEEECEEEECCC | 23.35 | - | |
326 | Phosphorylation | RLKRDMATSDIQMFH CCCCCCCCCCCHHHH | 21.94 | 27742792 | |
327 | Phosphorylation | LKRDMATSDIQMFHH CCCCCCCCCCHHHHH | 24.15 | 27742792 | |
336 | Phosphorylation | IQMFHHCSIHGNTEE CHHHHHHHCCCCHHH | 17.17 | 27742792 | |
341 | Phosphorylation | HCSIHGNTEELRQMA HHHCCCCHHHHHHHH | 35.11 | 27742792 | |
377 | Phosphorylation | RLPPRVDSAQMPLIL CCCCCCCCCCCCEEC | 19.97 | 23737553 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SGCA_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SGCA_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SGCA_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DAG1_MOUSE | Dag1 | physical | 1461282 | |
SGCB_MOUSE | Sgcb | physical | 1461282 | |
SGCD_MOUSE | Sgcd | physical | 1461282 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...