| UniProt ID | C2AIL_HUMAN | |
|---|---|---|
| UniProt AC | Q96HQ2 | |
| Protein Name | CDKN2AIP N-terminal-like protein | |
| Gene Name | CDKN2AIPNL | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 116 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MVGGEAAA -------CCCHHHHH | 5.96 | 22814378 | |
| 15 | Phosphorylation | AAVEELVSGVRQAAD HHHHHHHHHHHHHHH | 44.17 | 27251275 | |
| 35 | 2-Hydroxyisobutyrylation | RSYSESEKQWKARME HCCCHHHHHHHHHHH | 71.40 | - | |
| 35 | Ubiquitination | RSYSESEKQWKARME HCCCHHHHHHHHHHH | 71.40 | 29967540 | |
| 38 | Ubiquitination | SESEKQWKARMEFIL CHHHHHHHHHHHHHH | 24.50 | - | |
| 41 | Sulfoxidation | EKQWKARMEFILRHL HHHHHHHHHHHHHHC | 6.19 | 21406390 | |
| 66 (in isoform 2) | Phosphorylation | - | 27.30 | 24043423 | |
| 68 (in isoform 2) | Phosphorylation | - | 14.12 | 24043423 | |
| 80 | Phosphorylation | NHLFLGCSYNKDLLD HHHHHCCCCCHHHHH | 29.91 | 27050516 | |
| 80 (in isoform 2) | Phosphorylation | - | 29.91 | 24043423 | |
| 112 | Ubiquitination | TTRSELMKKHQS--- CCHHHHHHHHCC--- | 60.78 | 24816145 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of C2AIL_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of C2AIL_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of C2AIL_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TAF12_HUMAN | TAF12 | physical | 26496610 | |
| BCLF1_HUMAN | BCLAF1 | physical | 26496610 | |
| SC16A_HUMAN | SEC16A | physical | 26496610 | |
| XRN2_HUMAN | XRN2 | physical | 26496610 | |
| WAC_HUMAN | WAC | physical | 26496610 | |
| NCK5L_HUMAN | NCKAP5L | physical | 26496610 | |
| PSRC1_HUMAN | PSRC1 | physical | 26496610 | |
| PKHA8_HUMAN | PLEKHA8 | physical | 26496610 | |
| CHAP1_HUMAN | CHAMP1 | physical | 26496610 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. | |