UniProt ID | BRR6_SCHPO | |
---|---|---|
UniProt AC | Q9UT30 | |
Protein Name | Nucleus export protein brr6 | |
Gene Name | brr6 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 297 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Nucleus membrane Multi-pass membrane protein. |
|
Protein Description | Involved in mRNA and protein export from nucleus.. | |
Protein Sequence | MEMYVEDVPMPDIGPDSVLNTPIRPKYEILKSKKKTQNENDPEPMDISMSPDEKNLKKSTVRRKLRKSKPNSSSNQVSSRTRALTKRSNSSNAIIKANNQDSVYVSDWTNVHRDIPIVVSGYLQLMFNACVASIFLYFLFKIVFGIQNDVRNRVEYHKILQEEQAADCQREYLSINCDSPGPAIFEVCQKLKQCKMESSNNVGSTKLAALVFAEIIDAFISHISYKTMVFSLILVFGSLLTSNYAFGLYRARHSQNIHDYAANAIPAMIPSSRFLPSNLSDISNRNLIEAASQEEEI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
48 | Phosphorylation | DPEPMDISMSPDEKN CCCCCCCCCCCCHHH | 14.67 | 25720772 | |
50 | Phosphorylation | EPMDISMSPDEKNLK CCCCCCCCCCHHHHC | 23.55 | 25720772 | |
90 | Phosphorylation | ALTKRSNSSNAIIKA HHHHHCCCCCCEEEE | 26.64 | 28889911 | |
91 | Phosphorylation | LTKRSNSSNAIIKAN HHHHCCCCCCEEEEC | 34.23 | 24763107 | |
292 | Phosphorylation | RNLIEAASQEEEI-- HHHHHHHHHHCCC-- | 45.21 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BRR6_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BRR6_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BRR6_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDC31_SCHPO | cdc31 | genetic | 22042620 | |
CUT12_SCHPO | cut12 | genetic | 22042620 | |
KMS2_SCHPO | kms2 | genetic | 22042620 | |
SAD1_SCHPO | sad1 | genetic | 22042620 | |
KMS1_SCHPO | kms1 | genetic | 22042620 | |
APQ12_SCHPO | apq12 | genetic | 22042620 | |
SAD1_SCHPO | sad1 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...