UniProt ID | BRAP_MOUSE | |
---|---|---|
UniProt AC | Q99MP8 | |
Protein Name | BRCA1-associated protein | |
Gene Name | Brap {ECO:0000312|MGI:MGI:1919649} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 591 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Negatively regulates MAP kinase activation by limiting the formation of Raf/MEK complexes probably by inactivation of the KSR1 scaffold protein. Also acts as a Ras responsive E3 ubiquitin ligase that, on activation of Ras, is modified by auto-polyubiquitination resulting in the release of inhibition of Raf/MEK complex formation. May also act as a cytoplasmic retention protein with a role in regulating nuclear transport (By similarity).. | |
Protein Sequence | MSVSLVVIRLELAGHSPVPTDFGFSAAAGEMSDEEIKKKTLASAVACLEGKSAGEKAAIIHQHLGRREMTDVIIETMKARADEVRDTVEEKKPSAAPVSAQRSREQSESVNTAPESPSKQLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCVLTVPATMTSHDLMKFVAPFNDVIEQMKIIRDSTPNQYMVLIKFSAQADADSFYMACNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDSLELRLSDLLKEKQSVERKCTQLNTRVAKLSTELQEEQELNKCLRANQLVLQNQLKEEEKLLKETCAQKDLQITEIQEQLRDVMFYLETQQQISHLPAETRQEIQEGQINIAMASAPNPPSSGAGGKLQSRKGRSKRGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Phosphorylation | SAAAGEMSDEEIKKK CCCCCCCCHHHHHHH | 37.25 | 27681418 | |
52 | Phosphorylation | VACLEGKSAGEKAAI HHHHCCCCHHHHHHH | 52.98 | - | |
78 | Ubiquitination | DVIIETMKARADEVR HHHHHHHHHHHHHHH | 41.98 | 22790023 | |
94 | Phosphorylation | TVEEKKPSAAPVSAQ HHHHHCCCCCCCCHH | 46.04 | 23375375 | |
103 | Phosphorylation | APVSAQRSREQSESV CCCCHHHHHHHHHCC | 28.26 | 25619855 | |
107 | Phosphorylation | AQRSREQSESVNTAP HHHHHHHHHCCCCCC | 27.38 | 25619855 | |
109 | Phosphorylation | RSREQSESVNTAPES HHHHHHHCCCCCCCC | 26.39 | 25619855 | |
112 | Phosphorylation | EQSESVNTAPESPSK HHHHCCCCCCCCCCC | 41.24 | 25619855 | |
116 | Phosphorylation | SVNTAPESPSKQLPD CCCCCCCCCCCCCCC | 33.15 | 25521595 | |
118 | Phosphorylation | NTAPESPSKQLPDQI CCCCCCCCCCCCCCC | 42.17 | 27742792 | |
232 | Ubiquitination | FNSIEDDVCQLVYVE CCCCCCCCEEEEEEE | 3.29 | 27667366 | |
237 | Phosphorylation | DDVCQLVYVERAEVL CCCEEEEEEEEHHHE | 12.75 | 25338131 | |
240 | Ubiquitination | CQLVYVERAEVLKSE EEEEEEEEHHHEECC | 26.46 | 27667366 | |
304 | Phosphorylation | TTCPVCRYCQTPEPV CCCCCCCCCCCCCCC | 5.47 | 20469934 | |
307 | Phosphorylation | PVCRYCQTPEPVEEN CCCCCCCCCCCCCCC | 26.51 | 30635358 | |
350 | Ubiquitination | HAYKHFEETQHTYAM HHHHHHHHCCCEEEE | 53.47 | 27667366 | |
380 | Ubiquitination | VHRLVASKTDGKIVQ CEEEEEECCCCCEEE | 40.68 | 22790023 | |
384 | Ubiquitination | VASKTDGKIVQYECE EEECCCCCEEEEEEE | 42.38 | 22790023 | |
399 | Ubiquitination | GDTCQEEKIDALQLE CCCCCHHHCCHHHHH | 45.17 | - | |
421 | Phosphorylation | QLESQRIYWENKIVR HHHHCCEEEECCEEE | 14.62 | 25367039 | |
441 | Ubiquitination | AEEINNMKTKFKETI HHHHHHHHHHHHHHH | 51.16 | 22790023 | |
477 | Phosphorylation | RKCTQLNTRVAKLST HHHHHHHHHHHHHHH | 34.80 | 18779572 | |
494 | Ubiquitination | QEEQELNKCLRANQL HHHHHHHHHHHHHHH | 47.47 | 22790023 | |
508 | Ubiquitination | LVLQNQLKEEEKLLK HHHHHHHHHHHHHHH | 54.00 | 22790023 | |
517 | Phosphorylation | EEKLLKETCAQKDLQ HHHHHHHHHHHHCCC | 16.14 | 18779572 | |
579 | Ubiquitination | PSSGAGGKLQSRKGR CCCCCCCCCCCCCCC | 42.30 | 22790023 | |
582 | Phosphorylation | GAGGKLQSRKGRSKR CCCCCCCCCCCCCCC | 46.53 | 29514104 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BRAP_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BRAP_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BRAP_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAF1_MOUSE | Raf1 | physical | 18332145 | |
KSR1_MOUSE | Ksr1 | physical | 18332145 | |
MP2K1_MOUSE | Map2k1 | physical | 18332145 | |
SYNE2_MOUSE | Syne2 | physical | 23707952 | |
PHLP1_MOUSE | Phlpp1 | physical | 25820252 | |
AKAP3_MOUSE | Akap3 | physical | 25820252 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...