UniProt ID | BATF3_MOUSE | |
---|---|---|
UniProt AC | Q9D275 | |
Protein Name | Basic leucine zipper transcriptional factor ATF-like 3 | |
Gene Name | Batf3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 118 | |
Subcellular Localization | Nucleus . | |
Protein Description | AP-1 family transcription factor that controls the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha(+) classical dendritic cells (cDCs) and related CD103(+) dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens.. | |
Protein Sequence | MSQGPPAVSVLQRSVDAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEHESLEQENSVLRREISKLKEELRHLSEVLKEHEKMCPLLLCPMNFVQLRSDPVASCLPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BATF3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BATF3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BATF3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
JUNB_HUMAN | JUNB | physical | 26496610 | |
JUND_HUMAN | JUND | physical | 26496610 | |
MSH3_HUMAN | MSH3 | physical | 26496610 | |
PNPH_HUMAN | PNP | physical | 26496610 | |
SF3B2_HUMAN | SF3B2 | physical | 26496610 | |
TBC9B_HUMAN | TBC1D9B | physical | 26496610 | |
MACF1_HUMAN | MACF1 | physical | 26496610 | |
NSL1_HUMAN | NSL1 | physical | 26496610 | |
SRPRB_HUMAN | SRPRB | physical | 26496610 | |
SEN34_HUMAN | TSEN34 | physical | 26496610 | |
TIM23_HUMAN | TIMM23 | physical | 26496610 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...