dbPTM

BATF3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BATF3_MOUSE
UniProt AC	Q9D275
Protein Name	Basic leucine zipper transcriptional factor ATF-like 3
Gene Name	Batf3
Organism	Mus musculus (Mouse).
Sequence Length	118
Subcellular Localization	Nucleus .
Protein Description	AP-1 family transcription factor that controls the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha(+) classical dendritic cells (cDCs) and related CD103(+) dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens..
Protein Sequence	MSQGPPAVSVLQRSVDAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEHESLEQENSVLRREISKLKEELRHLSEVLKEHEKMCPLLLCPMNFVQLRSDPVASCLPR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2	Phosphorylation	------MSQGPPAVS ------CCCCCCCHH	43.79	29176673
24	Phosphorylation	APGNQPQSPKDDDRK CCCCCCCCCCCCCHH	40.37	25159016

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BATF3_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BATF3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BATF3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
JUNB_HUMAN	JUNB	physical	26496610
JUND_HUMAN	JUND	physical	26496610
MSH3_HUMAN	MSH3	physical	26496610
PNPH_HUMAN	PNP	physical	26496610
SF3B2_HUMAN	SF3B2	physical	26496610
TBC9B_HUMAN	TBC1D9B	physical	26496610
MACF1_HUMAN	MACF1	physical	26496610
NSL1_HUMAN	NSL1	physical	26496610
SRPRB_HUMAN	SRPRB	physical	26496610
SEN34_HUMAN	TSEN34	physical	26496610
TIM23_HUMAN	TIMM23	physical	26496610

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BATF3_MOUSE

Related Literatures of Post-Translational Modification