BAG1A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BAG1A_SCHPO
• UniProt AC: O60125
• Protein Name: BAG family molecular chaperone regulator 1A
• Gene Name: bag101
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 195
• Protein Description: Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release..
• Protein Sequence: MSEKTSTVTIHYGNQRFPVAVNLNETLSELIDDLLETTEISEKKVKLFYAGKRLKDKKASLSKLGLKNHSKILCIRPHKQQRGSKEKDTVEPAPKAEAENPVFSRISGEIKAIDQYVDKELSPMYDNYVNKPSNDPKQKNKQKLMISELLLQQLLKLDGVDVLGSEKLRFERKQLVSKIQKMLDHVDQTSQEVAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
104	Phosphorylation	EAENPVFSRISGEIK HHCCCCHHHHCCCHH	29.01	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BAG1A_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BAG1A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BAG1A_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SET6_SCHPO	set6	genetic	18818364
NSE6_SCHPO	nse6	genetic	22681890
BLT1_SCHPO	blt1	genetic	22681890
YI43_SCHPO	SPBC1348.03	genetic	22681890
RAD22_SCHPO	rad52	physical	23779158
RPN11_SCHPO	rpn11	physical	23779158
HSP7M_SCHPO	ssc1	physical	24497846
RPN11_SCHPO	rpn11	physical	24497846
RPN1_SCHPO	mts4	physical	24497846

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.