UniProt ID | BAG1A_SCHPO | |
---|---|---|
UniProt AC | O60125 | |
Protein Name | BAG family molecular chaperone regulator 1A | |
Gene Name | bag101 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 195 | |
Subcellular Localization | ||
Protein Description | Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release.. | |
Protein Sequence | MSEKTSTVTIHYGNQRFPVAVNLNETLSELIDDLLETTEISEKKVKLFYAGKRLKDKKASLSKLGLKNHSKILCIRPHKQQRGSKEKDTVEPAPKAEAENPVFSRISGEIKAIDQYVDKELSPMYDNYVNKPSNDPKQKNKQKLMISELLLQQLLKLDGVDVLGSEKLRFERKQLVSKIQKMLDHVDQTSQEVAA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
104 | Phosphorylation | EAENPVFSRISGEIK HHCCCCHHHHCCCHH | 29.01 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BAG1A_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BAG1A_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BAG1A_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SET6_SCHPO | set6 | genetic | 18818364 | |
NSE6_SCHPO | nse6 | genetic | 22681890 | |
BLT1_SCHPO | blt1 | genetic | 22681890 | |
YI43_SCHPO | SPBC1348.03 | genetic | 22681890 | |
RAD22_SCHPO | rad52 | physical | 23779158 | |
RPN11_SCHPO | rpn11 | physical | 23779158 | |
HSP7M_SCHPO | ssc1 | physical | 24497846 | |
RPN11_SCHPO | rpn11 | physical | 24497846 | |
RPN1_SCHPO | mts4 | physical | 24497846 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...