| UniProt ID | ARRC_HUMAN | |
|---|---|---|
| UniProt AC | P36575 | |
| Protein Name | Arrestin-C | |
| Gene Name | ARR3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 388 | |
| Subcellular Localization | ||
| Protein Description | May play a role in an as yet undefined retina-specific signal transduction. Could binds to photoactivated-phosphorylated red/green opsins.. | |
| Protein Sequence | MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAASSEDIVIEEFTRKGEEESQKAVEAEGDEGS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 20 | Acetylation | KLSIYLGKRDFVDHV CEEEEEECCCCCCCC | 46.31 | 25953088 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARRC_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARRC_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARRC_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GNMT_HUMAN | GNMT | physical | 16189514 | |
| DVL2_HUMAN | DVL2 | physical | 16189514 | |
| ZN496_HUMAN | ZNF496 | physical | 16189514 | |
| CPNS1_HUMAN | CAPNS1 | physical | 16169070 | |
| RNAS6_HUMAN | RNASE6 | physical | 16169070 | |
| OPSD_HUMAN | RHO | physical | 9852134 | |
| PLK4_HUMAN | PLK4 | physical | 25416956 | |
| ZBT43_HUMAN | ZBTB43 | physical | 25416956 | |
| ZN496_HUMAN | ZNF496 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...