UniProt ID | ARRC_HUMAN | |
---|---|---|
UniProt AC | P36575 | |
Protein Name | Arrestin-C | |
Gene Name | ARR3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 388 | |
Subcellular Localization | ||
Protein Description | May play a role in an as yet undefined retina-specific signal transduction. Could binds to photoactivated-phosphorylated red/green opsins.. | |
Protein Sequence | MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAASSEDIVIEEFTRKGEEESQKAVEAEGDEGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Acetylation | KLSIYLGKRDFVDHV CEEEEEECCCCCCCC | 46.31 | 25953088 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARRC_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARRC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARRC_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GNMT_HUMAN | GNMT | physical | 16189514 | |
DVL2_HUMAN | DVL2 | physical | 16189514 | |
ZN496_HUMAN | ZNF496 | physical | 16189514 | |
CPNS1_HUMAN | CAPNS1 | physical | 16169070 | |
RNAS6_HUMAN | RNASE6 | physical | 16169070 | |
OPSD_HUMAN | RHO | physical | 9852134 | |
PLK4_HUMAN | PLK4 | physical | 25416956 | |
ZBT43_HUMAN | ZBTB43 | physical | 25416956 | |
ZN496_HUMAN | ZNF496 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...