UniProt ID | RNAS6_HUMAN | |
---|---|---|
UniProt AC | Q93091 | |
Protein Name | Ribonuclease K6 | |
Gene Name | RNASE6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 150 | |
Subcellular Localization | Secreted . Lysosome . Cytoplasmic granule . | |
Protein Description | Ribonuclease which shows a preference for the pyrimidines uridine and cytosine. [PubMed: 8836175] | |
Protein Sequence | MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
55 | N-linked_Glycosylation | RAMSGINNYTQHCKH HHHHCCCHHHHHCCC | 39.03 | UniProtKB CARBOHYD | |
100 | N-linked_Glycosylation | HQSSKPVNMTDCRLT CCCCCCCCCCCCCCC | 35.84 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RNAS6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RNAS6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RNAS6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RNAS6_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...