UniProt ID | ARL6_HUMAN | |
---|---|---|
UniProt AC | Q9H0F7 | |
Protein Name | ADP-ribosylation factor-like protein 6 | |
Gene Name | ARL6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 186 | |
Subcellular Localization |
Cell projection, cilium membrane Peripheral membrane protein Cytoplasmic side. Cytoplasm, cytoskeleton, cilium axoneme. Cytoplasm, cytoskeleton, cilium basal body. Appears in a pattern of punctae flanking the microtubule axoneme that likely corresp |
|
Protein Description | Involved in membrane protein trafficking at the base of the ciliary organelle. Mediates recruitment onto plasma membrane of the BBSome complex which would constitute a coat complex required for sorting of specific membrane proteins to the primary cilia. [PubMed: 20603001 Together with BBS1, is necessary for correct trafficking of PKD1 to primary cilia (By similarity Together with the BBSome complex and LTZL1, controls SMO ciliary trafficking and contributes to the sonic hedgehog (SHH) pathway regulation] | |
Protein Sequence | MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGLLDRLSV ------CCHHHHHHH | 34.64 | - | |
14 | Acetylation | LSVLLGLKKKEVHVL HHHHHCCCCCEEEEE | 61.06 | 25953088 | |
28 | Phosphorylation | LCLGLDNSGKTTIIN EEEEECCCCCEEEEE | 41.14 | 30243723 | |
44 | Phosphorylation | LKPSNAQSQNILPTI CCCCCCCCCCCCCCC | 23.84 | 28348404 | |
76 | Phosphorylation | DMSGQGRYRNLWEHY ECCCCCCCHHHHHHH | 15.63 | 30622161 | |
83 | Phosphorylation | YRNLWEHYYKEGQAI CHHHHHHHHHCCCEE | 12.52 | 30622161 | |
84 | Phosphorylation | RNLWEHYYKEGQAII HHHHHHHHHCCCEEE | 12.41 | 30622161 | |
106 | Acetylation | RLRMVVAKEELDTLL CEEEEEEHHHHHHHH | 39.86 | 26822725 | |
119 | Acetylation | LLNHPDIKHRRIPIL HHCCCCCCCCCCCEE | 38.14 | 25953088 | |
142 | Ubiquitination | RDAVTSVKVSQLLCL HHHHHHCCHHHHHHH | 35.62 | - | |
148 | S-nitrosocysteine | VKVSQLLCLENIKDK CCHHHHHHHHCCCCC | 6.44 | - | |
148 | S-nitrosylation | VKVSQLLCLENIKDK CCHHHHHHHHCCCCC | 6.44 | 19483679 | |
185 | Ubiquitination | QDQIQTVKT------ HHHHHHCCC------ | 52.48 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PRAF3_HUMAN | ARL6IP5 | physical | 10508919 | |
AR6P4_HUMAN | ARL6IP4 | physical | 10508919 | |
AR6P1_HUMAN | ARL6IP1 | physical | 10508919 | |
ATLA2_HUMAN | ATL2 | physical | 10508919 | |
AR6P6_HUMAN | ARL6IP6 | physical | 10508919 | |
SC61B_HUMAN | SEC61B | physical | 10508919 | |
SNUT1_HUMAN | SART1 | physical | 27173435 |
loading...