AL3B2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AL3B2_HUMAN
• UniProt AC: P48448
• Protein Name: Aldehyde dehydrogenase family 3 member B2
• Gene Name: ALDH3B2
• Organism: Homo sapiens (Human).
• Sequence Length: 385
• Subcellular Localization: Lipid droplet .
• Protein Description: Oxidizes medium and long chain aldehydes into non-toxic fatty acids..
• Protein Sequence: MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGHIINQKQFQRLRALLGCSRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINRQEKPLALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
108	Phosphorylation	DYIFFTGSPRVGKIV CEEEEECCCCCHHHH	13.38	-
117	Phosphorylation	RVGKIVMTAATKHLT CCHHHHHHCCCCCCC	11.40	18491316
124	Phosphorylation	TAATKHLTPVTLELG HCCCCCCCCEEEEEC	18.55	46162047
127	Phosphorylation	TKHLTPVTLELGGKN CCCCCCEEEEECCCC	18.73	18491316
208	Ubiquitination	LGHIINQKQFQRLRA HHHHCCHHHHHHHHH	48.90	21906983
362	Phosphorylation	EKLKEIHYPPYTDWN HHHHHCCCCCCCCHH	16.15	20561469
365	Phosphorylation	KEIHYPPYTDWNQQL HHCCCCCCCCHHHHH	16.90	20561475
382	Methylation	WGMGSQSCTLL---- HCCCCCCCCCC----	2.11	-
382	Geranylgeranylation	WGMGSQSCTLL---- HCCCCCCCCCC----	2.11	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AL3B2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AL3B2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AL3B2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CLGN_HUMAN	CLGN	physical	26186194
OBSL1_HUMAN	OBSL1	physical	26186194
AL3B1_HUMAN	ALDH3B1	physical	26186194
COX16_HUMAN	COX16	physical	26186194
ZMYM2_HUMAN	ZMYM2	physical	26186194
AL3B1_HUMAN	ALDH3B1	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.