UniProt ID | 8ODP_HUMAN | |
---|---|---|
UniProt AC | P36639 | |
Protein Name | 7,8-dihydro-8-oxoguanine triphosphatase | |
Gene Name | NUDT1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 197 | |
Subcellular Localization | Isoform p18: Cytoplasm, cytosol . Mitochondrion matrix . Nucleus . Mostly present in cytosol (PubMed:7782328). A minor proportion is mitochondrial (PubMed:7782328). A very small amount of the protein is associated with nuclei (PubMed:7782328). Varian | |
Protein Description | Antimutagenic. [PubMed: 8226881] | |
Protein Sequence | MYWSNQITRRLGERVQGFMSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | ERVQGFMSGISPQQM HHHHHHHCCCCHHHC | 30.62 | 25907765 | |
23 | Phosphorylation | QGFMSGISPQQMGEP HHHHCCCCHHHCCCC | 21.85 | 25907765 | |
38 (in isoform 4) | Ubiquitination | - | 43.70 | 21906983 | |
45 | Phosphorylation | NPGTMGASRLYTLVL CCCCCCHHHHHHHHH | 19.65 | 27251275 | |
48 | Phosphorylation | TMGASRLYTLVLVLQ CCCHHHHHHHHHEEC | 9.27 | 23822953 | |
49 | Phosphorylation | MGASRLYTLVLVLQP CCHHHHHHHHHEECH | 18.25 | 27251275 | |
61 (in isoform 2) | Ubiquitination | - | 6.03 | 21906983 | |
61 (in isoform 3) | Ubiquitination | - | 6.03 | 21906983 | |
79 | Ubiquitination | RWNGFGGKVQEGETI CCCCCCCCCCCCCCC | 40.92 | 2190698 | |
79 | Acetylation | RWNGFGGKVQEGETI CCCCCCCCCCCCCCC | 40.92 | 23236377 | |
79 (in isoform 1) | Ubiquitination | - | 40.92 | 21906983 | |
98 | Phosphorylation | RRELQEESGLTVDAL HHHHHHHHCCCHHHH | 38.05 | 21406692 | |
101 | Phosphorylation | LQEESGLTVDALHKV HHHHHCCCHHHHHHH | 21.62 | 21406692 | |
189 | Phosphorylation | GQDTILDYTLREVDT CCCEEEEEEEEEECC | 12.29 | 27642862 | |
190 | Phosphorylation | QDTILDYTLREVDTV CCEEEEEEEEEECCC | 21.00 | 28555341 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 8ODP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 8ODP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MRM3_HUMAN | RNMTL1 | physical | 17353931 | |
SPIN3_HUMAN | SPIN3 | physical | 28514442 | |
ACY1_HUMAN | ACY1 | physical | 28514442 | |
RRAGB_HUMAN | RRAGB | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...