8ODP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: 8ODP_HUMAN
• UniProt AC: P36639
• Protein Name: 7,8-dihydro-8-oxoguanine triphosphatase
• Gene Name: NUDT1
• Organism: Homo sapiens (Human).
• Sequence Length: 197
• Subcellular Localization: Isoform p18: Cytoplasm, cytosol . Mitochondrion matrix . Nucleus . Mostly present in cytosol (PubMed:7782328). A minor proportion is mitochondrial (PubMed:7782328). A very small amount of the protein is associated with nuclei (PubMed:7782328). Varian
• Protein Description: Antimutagenic. [PubMed: 8226881]
• Protein Sequence: MYWSNQITRRLGERVQGFMSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Phosphorylation	ERVQGFMSGISPQQM HHHHHHHCCCCHHHC	30.62	25907765
23	Phosphorylation	QGFMSGISPQQMGEP HHHHCCCCHHHCCCC	21.85	25907765
38 (in isoform 4)	Ubiquitination	-	43.70	21906983
45	Phosphorylation	NPGTMGASRLYTLVL CCCCCCHHHHHHHHH	19.65	27251275
48	Phosphorylation	TMGASRLYTLVLVLQ CCCHHHHHHHHHEEC	9.27	23822953
49	Phosphorylation	MGASRLYTLVLVLQP CCHHHHHHHHHEECH	18.25	27251275
61 (in isoform 2)	Ubiquitination	-	6.03	21906983
61 (in isoform 3)	Ubiquitination	-	6.03	21906983
79	Ubiquitination	RWNGFGGKVQEGETI CCCCCCCCCCCCCCC	40.92	2190698
79	Acetylation	RWNGFGGKVQEGETI CCCCCCCCCCCCCCC	40.92	23236377
79 (in isoform 1)	Ubiquitination	-	40.92	21906983
98	Phosphorylation	RRELQEESGLTVDAL HHHHHHHHCCCHHHH	38.05	21406692
101	Phosphorylation	LQEESGLTVDALHKV HHHHHCCCHHHHHHH	21.62	21406692
189	Phosphorylation	GQDTILDYTLREVDT CCCEEEEEEEEEECC	12.29	27642862
190	Phosphorylation	QDTILDYTLREVDTV CCEEEEEEEEEECCC	21.00	28555341

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	SKP2	Q13309	PMID:28947420

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of 8ODP_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of 8ODP_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MRM3_HUMAN	RNMTL1	physical	17353931
SPIN3_HUMAN	SPIN3	physical	28514442
ACY1_HUMAN	ACY1	physical	28514442
RRAGB_HUMAN	RRAGB	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.