UniProt ID | SPIN3_HUMAN | |
---|---|---|
UniProt AC | Q5JUX0 | |
Protein Name | Spindlin-3 | |
Gene Name | SPIN3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 258 | |
Subcellular Localization | ||
Protein Description | Exhibits H3K4me3-binding activity.. | |
Protein Sequence | MKTPFGKAAAGQRSRTGAGHGSVSVTMIKRKAAHKKHRSRPTSQPRGNIVGCRIQHGWKDGDEPLTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELHRDERVSSLEVLPNRVASSRISDTHLAEIMVGKAVEHIFETEEGSKNEWRGMVLAQAPVMNTWFYITYEKDPVLYMYQLLDDYKDGDLRILQDSNDSPLAEREPGEVIDSLVGKQVEYAKDDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Methylation | ------MKTPFGKAA ------CCCCCCCCC | 65.98 | - | |
3 | Phosphorylation | -----MKTPFGKAAA -----CCCCCCCCCC | 23.66 | 24719451 | |
16 | Phosphorylation | AAGQRSRTGAGHGSV CCCCCCCCCCCCCCE | 32.41 | 20068231 | |
22 | Phosphorylation | RTGAGHGSVSVTMIK CCCCCCCCEEEEEEE | 12.92 | 20068231 | |
24 | Phosphorylation | GAGHGSVSVTMIKRK CCCCCCEEEEEEECH | 17.36 | 20068231 | |
26 | Phosphorylation | GHGSVSVTMIKRKAA CCCCEEEEEEECHHH | 12.98 | 20068231 | |
39 | Phosphorylation | AAHKKHRSRPTSQPR HHCHHHHCCCCCCCC | 42.19 | 22468782 | |
87 | Phosphorylation | PSLYLIKYDGFDCVY CCEEEEEECCCCEEE | 17.82 | 17053785 | |
94 | Phosphorylation | YDGFDCVYGLELHRD ECCCCEEEEEEECCC | 23.48 | - | |
105 | Phosphorylation | LHRDERVSSLEVLPN ECCCCCCCCEEECCC | 35.11 | - | |
116 | Phosphorylation | VLPNRVASSRISDTH ECCCCHHHCCCCHHH | 19.79 | 24719451 | |
120 | Phosphorylation | RVASSRISDTHLAEI CHHHCCCCHHHHHHH | 35.03 | 27050516 | |
122 | Phosphorylation | ASSRISDTHLAEIMV HHCCCCHHHHHHHHH | 16.40 | 29759185 | |
182 | Ubiquitination | YQLLDDYKDGDLRIL EEEHHHCCCCCEEEE | 63.33 | 22817900 | |
192 | Phosphorylation | DLRILQDSNDSPLAE CEEEEECCCCCCCCC | 29.58 | 30266825 | |
195 | Phosphorylation | ILQDSNDSPLAEREP EEECCCCCCCCCCCC | 26.51 | 19664994 | |
208 | Phosphorylation | EPGEVIDSLVGKQVE CCCCHHHHHCCCEEE | 17.52 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPIN3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPIN3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPIN3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SPIN3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...