UniProt ID | ZHD14_ARATH | |
---|---|---|
UniProt AC | Q9LQW3 | |
Protein Name | Zinc-finger homeodomain protein 14 | |
Gene Name | ZHD14 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 168 | |
Subcellular Localization | Nucleus. | |
Protein Description | Putative transcription factor.. | |
Protein Sequence | MQSTCVYRECMRNHAAKLGSYAIDGCREYSQPSTGDLCVACGCHRSYHRRIDVISSPQINHTRFPFTSLRRVKQLARLKWKTAEERNEEEEDDTEETSTEEKMTVQRRRKSKFTAEQREAMKDYAAKLGWTLKDKRALREEIRVFCEGIGVTRYHFKTWVNNNKKFYH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | Phosphorylation | VACGCHRSYHRRIDV ECCCCCCCCCCCCCE | 19880383 | ||
47 | Phosphorylation | ACGCHRSYHRRIDVI CCCCCCCCCCCCCEE | 19880383 | ||
55 | Phosphorylation | HRRIDVISSPQINHT CCCCCEECCCCCCCC | 25561503 | ||
56 | Phosphorylation | RRIDVISSPQINHTR CCCCEECCCCCCCCC | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZHD14_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZHD14_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZHD14_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MPK3_ARATH | MPK3 | physical | 21798944 | |
ZHD13_ARATH | HB27 | physical | 21798944 | |
IAA8_ARATH | IAA8 | physical | 21798944 | |
ZHD10_ARATH | HB23 | physical | 21798944 | |
U2A2A_ARATH | ATU2AF65A | physical | 21798944 | |
CAND1_ARATH | CAND1 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...