ZFN2A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ZFN2A_MOUSE
• UniProt AC: Q9JII7
• Protein Name: AN1-type zinc finger protein 2A
• Gene Name: Zfand2a
• Organism: Mus musculus (Mouse).
• Sequence Length: 171
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Sequence: MEFPDLGKHCSEPTCKQLDFLPITCDACKQDFCKDHFSYVGHKCPFAFKKDVQVPVCPLCNAPIPVKRGEIPDVVVGEHMDRDCTFHPGRNRNKVFTHRCSKEGCRKKEMLQLACAQCHGNFCIQHRHPLDHNCQAGSSSASRGRTSTSRAAEQKPSGVSWLAQRLRRTVK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
146	Phosphorylation	SSASRGRTSTSRAAE CCCCCCCCCCCHHHH	38.90	29176673
147	Phosphorylation	SASRGRTSTSRAAEQ CCCCCCCCCCHHHHH	24.03	29176673
148	Phosphorylation	ASRGRTSTSRAAEQK CCCCCCCCCHHHHHC	22.94	29176673
149	Phosphorylation	SRGRTSTSRAAEQKP CCCCCCCCHHHHHCC	21.49	29176673

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ZFN2A_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ZFN2A_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ZFN2A_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PSA1_MOUSE	Psma1	physical	16973439
PSMD1_MOUSE	Psmd1	physical	16973439
PSMD2_MOUSE	Psmd2	physical	16973439
HSP7C_MOUSE	Hspa8	physical	16973439
PSMD7_MOUSE	Psmd7	physical	16973439
PSDE_MOUSE	Psmd14	physical	16973439

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.