dbPTM

Z600_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	Z600_DROME
UniProt AC	P22469
Protein Name	Protein Z600 {ECO:0000303\|PubMed:2497054}
Gene Name	Z600 {ECO:0000303\|PubMed:2497054, ECO:0000312\|FlyBase:FBgn0004052}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	90
Subcellular Localization	Nucleus . Associates with chromatin in the syncytial blastoderm.
Protein Description	Cell cycle regulator that is involved in modulating and adjusting cell proliferation according to the requirements of the developmental program. [PubMed: 10850494]
Protein Sequence	MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPSSSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
22	Phosphorylation	NSLKIVETPKEQHEF HCCCEECCCHHHHCC	28.85	17431409
48	Phosphorylation	KYSLVPATPSSSGHG CEEEEECCCCCCCCC	20.03	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of Z600_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of Z600_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of Z600_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CCNE_DROME	CycE	genetic	17431409
XPO1_DROME	emb	physical	17431409
CCNE_DROME	CycE	physical	17431409
NUP54_DROME	Nup54	physical	17431409
CCNB_DROME	CycB	physical	17431409
CCNA_DROME	CycA	physical	17431409
CCNB3_DROME	CycB3	physical	17431409
NU214_DROME	Nup214	physical	17431409

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of Z600_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-48, AND MASSSPECTROMETRY.	18327897 [Abstract]