dbPTM

YL406_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YL406_YEAST
UniProt AC	Q8TGT1
Protein Name	Uncharacterized protein YLR406C-A
Gene Name	YLR406C-A
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	49
Subcellular Localization
Protein Description
Protein Sequence	MIQKPILLSSFLFLYIRALLHSIHPYIRTSVHLYTKKITSYNFLGVPFK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YL406_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YL406_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YL406_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YL406_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MCM1_YEAST	MCM1	genetic	27708008
MOB1_YEAST	MOB1	genetic	27708008
SEC65_YEAST	SEC65	genetic	27708008
MOT1_YEAST	MOT1	genetic	27708008
ATG14_YEAST	ATG14	genetic	27708008
SPO73_YEAST	SPO73	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YL406_YEAST

Related Literatures of Post-Translational Modification