YK068_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YK068_YEAST
• UniProt AC: Q3E826
• Protein Name: Uncharacterized protein YKL068W-A
• Gene Name: YKL068W-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 78
• Protein Sequence: MQANHSVSYLYESSTSKRSNGLFSQTQKQGSFQKALSQTQEEIEDEDLMVDLNTGSLTPVKLKYWTQMSAMTEKFGKL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
28	Ubiquitination	GLFSQTQKQGSFQKA CCCHHHHHHHHHHHH	61.07	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YK068_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YK068_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YK068_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DPOA2_YEAST	POL12	genetic	27708008
RSP5_YEAST	RSP5	genetic	27708008
PRP18_YEAST	PRP18	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
SC61A_YEAST	SEC61	genetic	27708008
LIP1_YEAST	LIP1	genetic	27708008
RPB2_YEAST	RPB2	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.