dbPTM

YJY2_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YJY2_YEAST
UniProt AC	P47087
Protein Name	Uncharacterized protein YJR012C
Gene Name	YJR012C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	207
Subcellular Localization	Membrane Single-pass membrane protein .
Protein Description
Protein Sequence	MTVQSSPILRQSSFNFITFYLACQLLTFLCIYIVFFFVKFLPTIKVSFIIIGACKRAPHVSVYLLKIDCEHNESSMAAGGELSYEELLDHILNNKPIPNIVEVPNVTLDEGLASTPSLRPRPRPWEGQLQHQSHQGSLDKPNISLDIDQESLEGMTSLTRLSECYDIQSKLQINDSDNDNDDNNNDNNKGDGNDDDNNTVTANPTAR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTVQSSPIL ------CCCCCCCCH	27.53	30377154
5	Phosphorylation	---MTVQSSPILRQS ---CCCCCCCCHHHC	33.47	30377154
162	Phosphorylation	MTSLTRLSECYDIQS HHHHHHHHHHCCHHH	23.48	28132839
169	Phosphorylation	SECYDIQSKLQINDS HHHCCHHHCCCCCCC	35.35	27017623
176	Phosphorylation	SKLQINDSDNDNDDN HCCCCCCCCCCCCCC	33.55	19823750
199	Phosphorylation	GNDDDNNTVTANPTA CCCCCCCEECCCCCC	26.03	19779198
201	Phosphorylation	DDDNNTVTANPTAR- CCCCCEECCCCCCC-	20.76	29136822

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YJY2_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YJY2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YJY2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HOL1_YEAST	HOL1	physical	14690591
MMP1_YEAST	MMP1	physical	14690591
PEX7_YEAST	PEX7	physical	14690591
PLB1_YEAST	PLB1	physical	14690591
PEX7_YEAST	PEX7	physical	16554755

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YJY2_YEAST

Related Literatures of Post-Translational Modification