YHI3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YHI3_SCHPO
• UniProt AC: O13619
• Protein Name: Uncharacterized protein P22H7.03
• Gene Name: pi028, SPBP22H7.03
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 181
• Subcellular Localization: Cytoplasm . Membrane ; Single-pass membrane protein .
• Protein Sequence: MSQSPIDYNESLRPDDMLDNELNYELANEVSAGDEEPYDDDIWESEDLEPVGHDIQPMDSVSDFHVKDFSEKKYSPYTDEIASAQLTGPSESAFGSASSLGTVESPVTMQSATLLWDPSVKEVDDILHNEDFYDGRDLNIFTLRGFVNILTLILLSCGLLMLFIGYPILSAVEVEKQRKKN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YHI3_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YHI3_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YHI3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YHI3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BGS1_SCHPO	bgs1	physical	27749909
BGS1_SCHPO	bgs1	genetic	27749909
FLP1_SCHPO	clp1	genetic	27749909
RGA7_SCHPO	rga7	physical	27749909
IMP2_SCHPO	imp2	physical	27749909
CDC15_SCHPO	cdc15	physical	27749909
YOCC_SCHPO	pxl1	physical	27749909
YHI3_SCHPO	SPBP22H7.03	physical	27749909
RGA7_SCHPO	rga7	genetic	27749909
YOCC_SCHPO	pxl1	genetic	27749909
IMP2_SCHPO	imp2	genetic	27749909

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.