YB008_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YB008_YEAST
• UniProt AC: Q3E821
• Protein Name: Uncharacterized protein YBL008W-A
• Gene Name: YBL008W-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 79
• Subcellular Localization: Secreted .
• Protein Sequence: MKMNPCTVILCKSLFFFCLFQVDCYCNRKNIQNQSSRIATKIKRSYWFRWQKHIILANIHKIIKAYQRSIIKLPVTKGL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
33	N-linked_Glycosylation	CNRKNIQNQSSRIAT HCCCCCCCCHHHHHH	39.65	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YB008_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YB008_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YB008_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARO8_YEAST	ARO8	genetic	27708008
MED20_YEAST	SRB2	genetic	27708008
SAC1_YEAST	SAC1	genetic	27708008
GBLP_YEAST	ASC1	genetic	27708008
EOS1_YEAST	EOS1	genetic	27708008
BUD21_YEAST	BUD21	genetic	27708008
APC11_YEAST	APC11	genetic	27708008
BCP1_YEAST	BCP1	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
CDC12_YEAST	CDC12	genetic	27708008
AIM4_YEAST	AIM4	genetic	27708008
PP2C1_YEAST	PTC1	genetic	27708008
SNF11_YEAST	SNF11	genetic	27708008
LSM6_YEAST	LSM6	genetic	27708008
CAC2_YEAST	CAC2	genetic	27708008
RLF2_YEAST	RLF2	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.