UniProt ID | XAGE2_HUMAN | |
---|---|---|
UniProt AC | Q96GT9 | |
Protein Name | X antigen family member 2 | |
Gene Name | XAGE2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 111 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | YRPRPRRSLQPPELI CCCCCCCCCCCHHHH | 30243723 | ||
30 | Phosphorylation | IGAMLEPTDEEPKEE HCCCCCCCCCCCCCC | 30243723 | ||
43 | Phosphorylation | EEKPPTKSRNPTPDQ CCCCCCCCCCCCCCC | 28102081 | ||
47 | Phosphorylation | PTKSRNPTPDQKRED CCCCCCCCCCCCCCC | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of XAGE2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of XAGE2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of XAGE2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EHMT2_HUMAN | EHMT2 | physical | 16189514 | |
GMCL1_HUMAN | GMCL1 | physical | 25416956 | |
WIZ_HUMAN | WIZ | physical | 28514442 | |
EHMT2_HUMAN | EHMT2 | physical | 28514442 | |
ZN644_HUMAN | ZNF644 | physical | 28514442 | |
EHMT1_HUMAN | EHMT1 | physical | 28514442 | |
GMCL1_HUMAN | GMCL1 | physical | 28514442 | |
CBX5_HUMAN | CBX5 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...