dbPTM

WPP1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	WPP1_ARATH
UniProt AC	Q9FMH6
Protein Name	WPP domain-containing protein 1
Gene Name	WPP1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	155
Subcellular Localization	Nucleus envelope . Cytoplasm . Nucleus . Golgi apparatus. Nucleus matrix. Associated to the nuclear envelope (NE) in undifferentiated cells of the root tip. Associated with the outer NE and the nuclear pores in interphase cells and with the immature
Protein Description	Regulates the mitotic activity in roots. Plays a role with HSP70-1 in facilitating WIT1 nuclear envelope targeting..
Protein Sequence	MAETETESITTSSPPPISETENSTTLPTTETEKNPNPVTISLRIWPPTQKTRDAVINRLIETLSTESILSKRFGSLESEEASSVAKSIEDEAYAIASATVFGDDDGIEILKAYSKEISKRMLESVKAKSNVASPPPKDGDGIESAVDSKIDSSEA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
129	Phosphorylation	LESVKAKSNVASPPP HHHHHHHCCCCCCCC	41.20	27545962
133	Phosphorylation	KAKSNVASPPPKDGD HHHCCCCCCCCCCCC	33.39	30291188
144	Phosphorylation	KDGDGIESAVDSKID CCCCCHHHHHHHCCC	31.50	24243849

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of WPP1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of WPP1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of WPP1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HSP7N_ARATH	ERD2	physical	19617588
HSP7E_ARATH	Hsp70b	physical	19617588
MD37C_ARATH	HSP70	physical	19617588
MD37D_ARATH	AT5G02490	physical	19617588
HSP7C_ARATH	AT3G09440	physical	19617588
MD37E_ARATH	HSC70-1	physical	19617588
MD37F_ARATH	BIP2	physical	19617588
MD37A_ARATH	BIP1	physical	19617588
WIT1_ARATH	WIT1	physical	19617588

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of WPP1_ARATH

Related Literatures of Post-Translational Modification