UniProt ID | WPP1_ARATH | |
---|---|---|
UniProt AC | Q9FMH6 | |
Protein Name | WPP domain-containing protein 1 | |
Gene Name | WPP1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 155 | |
Subcellular Localization | Nucleus envelope . Cytoplasm . Nucleus . Golgi apparatus. Nucleus matrix. Associated to the nuclear envelope (NE) in undifferentiated cells of the root tip. Associated with the outer NE and the nuclear pores in interphase cells and with the immature | |
Protein Description | Regulates the mitotic activity in roots. Plays a role with HSP70-1 in facilitating WIT1 nuclear envelope targeting.. | |
Protein Sequence | MAETETESITTSSPPPISETENSTTLPTTETEKNPNPVTISLRIWPPTQKTRDAVINRLIETLSTESILSKRFGSLESEEASSVAKSIEDEAYAIASATVFGDDDGIEILKAYSKEISKRMLESVKAKSNVASPPPKDGDGIESAVDSKIDSSEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
129 | Phosphorylation | LESVKAKSNVASPPP HHHHHHHCCCCCCCC | 41.20 | 27545962 | |
133 | Phosphorylation | KAKSNVASPPPKDGD HHHCCCCCCCCCCCC | 33.39 | 30291188 | |
144 | Phosphorylation | KDGDGIESAVDSKID CCCCCHHHHHHHCCC | 31.50 | 24243849 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WPP1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WPP1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WPP1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HSP7N_ARATH | ERD2 | physical | 19617588 | |
HSP7E_ARATH | Hsp70b | physical | 19617588 | |
MD37C_ARATH | HSP70 | physical | 19617588 | |
MD37D_ARATH | AT5G02490 | physical | 19617588 | |
HSP7C_ARATH | AT3G09440 | physical | 19617588 | |
MD37E_ARATH | HSC70-1 | physical | 19617588 | |
MD37F_ARATH | BIP2 | physical | 19617588 | |
MD37A_ARATH | BIP1 | physical | 19617588 | |
WIT1_ARATH | WIT1 | physical | 19617588 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...