UniProt ID | WNT1_HUMAN | |
---|---|---|
UniProt AC | P04628 | |
Protein Name | Proto-oncogene Wnt-1 | |
Gene Name | WNT1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 370 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix . Secreted . | |
Protein Description | Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation. [PubMed: 23499309] | |
Protein Sequence | MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | N-linked_Glycosylation | LPAALAANSSGRWWG HHHHHHHCCCCCCEE | 30.97 | UniProtKB CARBOHYD | |
81 | Phosphorylation | QNPGILHSVSGGLQS HCCCHHHHHCCHHHH | 17.96 | 22210691 | |
88 | Phosphorylation | SVSGGLQSAVRECKW HHCCHHHHHHHHHHH | 33.50 | 22210691 | |
132 | Phosphorylation | AFIFAITSAGVTHSV HEEEEEECCCCCHHH | 19.53 | - | |
136 | Phosphorylation | AITSAGVTHSVARSC EEECCCCCHHHHHHC | 13.91 | - | |
144 | Phosphorylation | HSVARSCSEGSIESC HHHHHHCCCCCEEEE | 46.36 | - | |
224 | O-palmitoleoylation | ECKCHGMSGSCTVRT HHHHCCCCCCCEEEE | 31.95 | - | |
254 | Phosphorylation | RDRFDGASRVLYGNR HHCCCCCCCEEECCC | 28.57 | 25954137 | |
316 | N-linked_Glycosylation | GTAGRACNSSSPALD CCCHHHCCCCCCCCC | 43.89 | UniProtKB CARBOHYD | |
346 | N-linked_Glycosylation | QRVTERCNCTFHWCC HHHHHHCCCEEEEEE | 33.80 | UniProtKB CARBOHYD | |
348 | Phosphorylation | VTERCNCTFHWCCHV HHHHCCCEEEEEEEE | 12.44 | 30576142 | |
356 | Phosphorylation | FHWCCHVSCRNCTHT EEEEEEEECCCCCCC | 5.45 | 30576142 | |
359 | N-linked_Glycosylation | CCHVSCRNCTHTRVL EEEEECCCCCCCHHH | 39.09 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WNT1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WNT1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WNT1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SFRP1_HUMAN | SFRP1 | physical | 10347172 | |
FZD8_HUMAN | FZD8 | physical | 11448771 | |
UBR3_HUMAN | UBR3 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...