UniProt ID | SFRP1_HUMAN | |
---|---|---|
UniProt AC | Q8N474 | |
Protein Name | Secreted frizzled-related protein 1 | |
Gene Name | SFRP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 314 | |
Subcellular Localization | Secreted. Cell membrane or extracellular matrix-associated. Released by heparin-binding. | |
Protein Description | Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP1 decreases intracellular beta-catenin levels (By similarity). Has antiproliferative effects on vascular cells, in vitro and in vivo, and can induce, in vivo, an angiogenic response. In vascular cell cycle, delays the G1 phase and entry into the S phase (By similarity). In kidney development, inhibits tubule formation and bud growth in metanephroi (By similarity). Inhibits WNT1/WNT4-mediated TCF-dependent transcription.. | |
Protein Sequence | MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | O-linked_Glycosylation | ASEYDYVSFQSDIGP CCCCCEEEECCCCCC | 16.02 | OGP | |
173 | N-linked_Glycosylation | CIAMTPPNATEASKP EEEECCCCCCCCCCC | 61.78 | 11741940 | |
175 | O-linked_Glycosylation | AMTPPNATEASKPQG EECCCCCCCCCCCCC | 38.43 | OGP | |
183 | O-linked_Glycosylation | EASKPQGTTVCPPCD CCCCCCCCCCCCCCC | 15.71 | OGP | |
184 | O-linked_Glycosylation | ASKPQGTTVCPPCDN CCCCCCCCCCCCCCC | 27.25 | OGP | |
223 | Acetylation | VKKENGDKKIVPKKK HHHHHCCCCCCCCCC | 45.88 | 88849 | |
224 | Acetylation | KKENGDKKIVPKKKK HHHHCCCCCCCCCCC | 54.39 | 88845 | |
231 | Acetylation | KIVPKKKKPLKLGPI CCCCCCCCCCCCCCC | 65.54 | 88853 | |
239 | Acetylation | PLKLGPIKKKDLKKL CCCCCCCCHHHHHHH | 57.83 | 88857 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SFRP1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SFRP1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SFRP1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FZD6_HUMAN | FZD6 | physical | 10347172 | |
WNT4_HUMAN | WNT4 | physical | 11287180 | |
PP1G_HUMAN | PPP1CC | physical | 21382349 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Disulfide bond assignments of secreted Frizzled-related protein-1provide insights about Frizzled homology and netrin modules."; Chong J.M., Ueren A., Rubin J.S., Speicher D.W.; J. Biol. Chem. 277:5134-5144(2002). Cited for: PROTEIN SEQUENCE OF 32-314, DISULFIDE BONDS, MASS SPECTROMETRY,GLYCOSYLATION AT ASN-173, AND MUTAGENESIS OF ASN-173 AND ASN-263. |