UniProt ID | FZD6_HUMAN | |
---|---|---|
UniProt AC | O60353 | |
Protein Name | Frizzled-6 | |
Gene Name | FZD6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 706 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . Cell membrane Multi-pass membrane protein . Cell surface . Apical cell membrane Multi-pass membrane protein . Cytoplasmic vesicle membrane Multi-pass membrane protein . Colocalizes with FZD3 at the apical |
|
Protein Description | Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Together with FZD3, is involved in the neural tube closure and plays a role in the regulation of the establishment of planar cell polarity (PCP), particularly in the orientation of asymmetric bundles of stereocilia on the apical faces of a subset of auditory and vestibular sensory cells located in the inner ear (By similarity).. | |
Protein Sequence | MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MEMFTFLLTCIF ---CCHHHHHHHHHH | 16.44 | - | |
28 | Phosphorylation | LFTCEPITVPRCMKM CCCCCCCCHHHHHHH | 34.86 | 24719451 | |
38 | N-linked_Glycosylation | RCMKMAYNMTFFPNL HHHHHHHHCCCCHHH | 17.30 | UniProtKB CARBOHYD | |
108 | Ubiquitination | KVYSDCKKLIDTFGI HHHHHHHHHHHHHCC | 57.94 | - | |
136 | O-linked_Glycosylation | CDETVPVTFDPHTEF CCCCCCCEECCCCCC | 19.09 | OGP | |
141 | O-linked_Glycosylation | PVTFDPHTEFLGPQK CCEECCCCCCCCCHH | 33.54 | OGP | |
148 | Ubiquitination | TEFLGPQKKTEQVQR CCCCCCHHCCHHHHH | 65.87 | - | |
150 | O-linked_Glycosylation | FLGPQKKTEQVQRDI CCCCHHCCHHHHHHH | 38.39 | 55831897 | |
166 | Ubiquitination | FWCPRHLKTSGGQGY CCCCCCCCCCCCCCC | 34.22 | - | |
191 | Ubiquitination | PCPNMYFKSDELEFA CCCCCEECHHHHHHH | 39.24 | 21906983 | |
352 | N-linked_Glycosylation | MNKVEGDNISGVCFV HHCCCCCCCCCEEEE | 40.98 | UniProtKB CARBOHYD | |
496 | Phosphorylation | SAVFWVGSKKTCTEW HHHEECCCCCCHHHH | 22.74 | - | |
517 | Phosphorylation | NRKRDPISESRRVLQ CCCCCCCCHHHHHHH | 34.60 | 28348404 | |
519 | Phosphorylation | KRDPISESRRVLQES CCCCCCHHHHHHHHH | 20.70 | 23312004 | |
526 | Phosphorylation | SRRVLQESCEFFLKH HHHHHHHHHHHHHHC | 13.14 | 21712546 | |
532 | Ubiquitination | ESCEFFLKHNSKVKH HHHHHHHHCCHHCCC | 35.27 | - | |
532 | Methylation | ESCEFFLKHNSKVKH HHHHHHHHCCHHCCC | 35.27 | - | |
545 | Ubiquitination | KHKKKHYKPSSHKLK CCCCCCCCCCHHHCE | 37.84 | - | |
547 | Phosphorylation | KKKHYKPSSHKLKVI CCCCCCCCHHHCEEE | 40.71 | 28152594 | |
548 | Phosphorylation | KKHYKPSSHKLKVIS CCCCCCCHHHCEEEE | 32.92 | 28152594 | |
580 | Phosphorylation | VAITSHDYLGQETLT EEEECCCCCCCCHHH | 13.81 | 27642862 | |
592 | Phosphorylation | TLTEIQTSPETSMRE HHHHCCCCCCCCCCH | 12.36 | 30624053 | |
606 | Phosphorylation | EVKADGASTPRLREQ HHCCCCCCCCCCCCC | 44.46 | 25159151 | |
607 | Phosphorylation | VKADGASTPRLREQD HCCCCCCCCCCCCCC | 16.34 | 25159151 | |
620 | Phosphorylation | QDCGEPASPAASISR CCCCCCCCCCHHHHH | 26.28 | 30266825 | |
624 | Phosphorylation | EPASPAASISRLSGE CCCCCCHHHHHHCCC | 24.17 | 30266825 | |
626 | Phosphorylation | ASPAASISRLSGEQV CCCCHHHHHHCCCCC | 25.36 | 30266825 | |
629 | Phosphorylation | AASISRLSGEQVDGK CHHHHHHCCCCCCCC | 38.89 | 29255136 | |
636 | Ubiquitination | SGEQVDGKGQAGSVS CCCCCCCCCCCCCCC | 43.30 | 21906983 | |
641 | Phosphorylation | DGKGQAGSVSESARS CCCCCCCCCCHHHHH | 26.03 | 29255136 | |
643 | Phosphorylation | KGQAGSVSESARSEG CCCCCCCCHHHHHCC | 27.77 | 29255136 | |
645 | Phosphorylation | QAGSVSESARSEGRI CCCCCCHHHHHCCCC | 22.83 | 27794612 | |
648 | Phosphorylation | SVSESARSEGRISPK CCCHHHHHCCCCCCC | 44.08 | 23663014 | |
653 | Phosphorylation | ARSEGRISPKSDITD HHHCCCCCCCCCCCC | 25.55 | 28355574 | |
656 | Phosphorylation | EGRISPKSDITDTGL CCCCCCCCCCCCCCC | 37.31 | 30266825 | |
659 | Phosphorylation | ISPKSDITDTGLAQS CCCCCCCCCCCCHHC | 32.28 | 23663014 | |
661 | Phosphorylation | PKSDITDTGLAQSNN CCCCCCCCCCHHCCC | 25.99 | 23663014 | |
666 | Phosphorylation | TDTGLAQSNNLQVPS CCCCCHHCCCCCCCC | 23.29 | 23663014 | |
673 | Phosphorylation | SNNLQVPSSSEPSSL CCCCCCCCCCCCCCC | 47.87 | 23090842 | |
674 | Phosphorylation | NNLQVPSSSEPSSLK CCCCCCCCCCCCCCC | 32.43 | 23090842 | |
675 | Phosphorylation | NLQVPSSSEPSSLKG CCCCCCCCCCCCCCC | 58.84 | 23090842 | |
678 | Phosphorylation | VPSSSEPSSLKGSTS CCCCCCCCCCCCCCE | 44.22 | 23090842 | |
679 | Phosphorylation | PSSSEPSSLKGSTSL CCCCCCCCCCCCCEE | 44.83 | 23090842 | |
681 | Ubiquitination | SSEPSSLKGSTSLLV CCCCCCCCCCCEEEE | 53.41 | - | |
683 | Phosphorylation | EPSSLKGSTSLLVHP CCCCCCCCCEEEEEE | 17.15 | 29514088 | |
684 | Phosphorylation | PSSLKGSTSLLVHPV CCCCCCCCEEEEEEC | 31.87 | 29514088 | |
685 | Phosphorylation | SSLKGSTSLLVHPVS CCCCCCCEEEEEECC | 22.77 | 29514088 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FZD6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FZD6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SFRP1_HUMAN | SFRP1 | physical | 10347172 |
loading...
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-606 AND THR-607, ANDMASS SPECTROMETRY. |