UniProt ID | WIF1_HUMAN | |
---|---|---|
UniProt AC | Q9Y5W5 | |
Protein Name | Wnt inhibitory factor 1 | |
Gene Name | WIF1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 379 | |
Subcellular Localization | Secreted. | |
Protein Description | Binds to WNT proteins and inhibits their activities. May be involved in mesoderm segmentation.. | |
Protein Sequence | MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
88 | N-linked_Glycosylation | PVNIHSMNFTWQAAG CEEEEECCEEEEECC | 33.92 | UniProtKB CARBOHYD | |
108 | Phosphorylation | YEFLSLRSLDKGIMA HHHHHHCCCCCCCCC | 46.33 | 26307563 | |
118 | Phosphorylation | KGIMADPTVNVPLLG CCCCCCCCCCCCCCC | 25.84 | 26307563 | |
126 | Phosphorylation | VNVPLLGTVPHKASV CCCCCCCCCCCCCEE | 30.73 | 26307563 | |
132 | Phosphorylation | GTVPHKASVVQVGFP CCCCCCCEEEEECCC | 27.85 | 26307563 | |
215 | Phosphorylation | HCEKALCTPRCMNGG CCCCCCCCCCCCCCC | 18.02 | - | |
245 | N-linked_Glycosylation | GVNCDKANCSTTCFN CCCCCCCCCCCEECC | 26.47 | UniProtKB CARBOHYD | |
255 | Phosphorylation | TTCFNGGTCFYPGKC CEECCCCEEEECCEE | 10.80 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WIF1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WIF1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WIF1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
WNT1_HUMAN | WNT1 | physical | 19174556 | |
KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...