| UniProt ID | WIF1_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y5W5 | |
| Protein Name | Wnt inhibitory factor 1 | |
| Gene Name | WIF1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 379 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Binds to WNT proteins and inhibits their activities. May be involved in mesoderm segmentation.. | |
| Protein Sequence | MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 88 | N-linked_Glycosylation | PVNIHSMNFTWQAAG CEEEEECCEEEEECC | 33.92 | UniProtKB CARBOHYD | |
| 108 | Phosphorylation | YEFLSLRSLDKGIMA HHHHHHCCCCCCCCC | 46.33 | 26307563 | |
| 118 | Phosphorylation | KGIMADPTVNVPLLG CCCCCCCCCCCCCCC | 25.84 | 26307563 | |
| 126 | Phosphorylation | VNVPLLGTVPHKASV CCCCCCCCCCCCCEE | 30.73 | 26307563 | |
| 132 | Phosphorylation | GTVPHKASVVQVGFP CCCCCCCEEEEECCC | 27.85 | 26307563 | |
| 215 | Phosphorylation | HCEKALCTPRCMNGG CCCCCCCCCCCCCCC | 18.02 | - | |
| 245 | N-linked_Glycosylation | GVNCDKANCSTTCFN CCCCCCCCCCCEECC | 26.47 | UniProtKB CARBOHYD | |
| 255 | Phosphorylation | TTCFNGGTCFYPGKC CEECCCCEEEECCEE | 10.80 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WIF1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WIF1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WIF1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| WNT1_HUMAN | WNT1 | physical | 19174556 | |
| KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...