UniProt ID | WIF1_DROME | |
---|---|---|
UniProt AC | Q9W3W5 | |
Protein Name | Protein shifted | |
Gene Name | shf | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 456 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix . Colocalizes with HSPG. | |
Protein Description | Required for normal accumulation and movement of lipid-modified hedgehog (hh) morphogen. May act by stabilizing the interaction between heparan sulfate proteoglycans (HSPGs) and hh, HSPGs being required for diffusion of hh morphogen. Not involved in wingless (wg) morphogen movement, suggesting that it may provide HSPG specificity for Hh.. | |
Protein Sequence | MTHQGIGCLVKWLYLVLIVHTLLCIGQLECRQQHHNRNNNNNNRRADSSSSEEGHGNTSDGLDNFADQDASFVGHGHQPRRGQRKKQQGGGGGGSGGGGGNGGGGGSRHNRNEESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRVTNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKCRNGTCVSHKHCKCHPGFYGRHCNGRKRRHVHRNDDSKF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
57 | N-linked_Glycosylation | SSEEGHGNTSDGLDN CCCCCCCCCCCCHHH | 30.63 | - | |
173 | N-linked_Glycosylation | PSEVNYVNFTWKSGR CCCCCEEEEEEECCC | 20.47 | - | |
217 | N-linked_Glycosylation | RIPQEQKNFSIFLPC CCCHHHCCEEEEEEE | 35.28 | - | |
227 | N-linked_Glycosylation | IFLPCTGNSSGTASF EEEEECCCCCCCEEE | 18.17 | - | |
324 | N-linked_Glycosylation | PQCLNGGNCTAPSVC CCCCCCCCCCCCCEE | 22.74 | - | |
420 | N-linked_Glycosylation | RSICKCRNGTCVSHK CCEEECCCCEEECCC | 60.64 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WIF1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WIF1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WIF1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IHOG_DROME | ihog | physical | 23276604 | |
DALY_DROME | dally | physical | 23276604 | |
HH_DROME | hh | physical | 15691765 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...