WIF1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: WIF1_DROME
• UniProt AC: Q9W3W5
• Protein Name: Protein shifted
• Gene Name: shf
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 456
• Subcellular Localization: Secreted, extracellular space, extracellular matrix . Colocalizes with HSPG.
• Protein Description: Required for normal accumulation and movement of lipid-modified hedgehog (hh) morphogen. May act by stabilizing the interaction between heparan sulfate proteoglycans (HSPGs) and hh, HSPGs being required for diffusion of hh morphogen. Not involved in wingless (wg) morphogen movement, suggesting that it may provide HSPG specificity for Hh..
• Protein Sequence: MTHQGIGCLVKWLYLVLIVHTLLCIGQLECRQQHHNRNNNNNNRRADSSSSEEGHGNTSDGLDNFADQDASFVGHGHQPRRGQRKKQQGGGGGGSGGGGGNGGGGGSRHNRNEESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRVTNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKCRNGTCVSHKHCKCHPGFYGRHCNGRKRRHVHRNDDSKF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
57	N-linked_Glycosylation	SSEEGHGNTSDGLDN CCCCCCCCCCCCHHH	30.63	-
173	N-linked_Glycosylation	PSEVNYVNFTWKSGR CCCCCEEEEEEECCC	20.47	-
217	N-linked_Glycosylation	RIPQEQKNFSIFLPC CCCHHHCCEEEEEEE	35.28	-
227	N-linked_Glycosylation	IFLPCTGNSSGTASF EEEEECCCCCCCEEE	18.17	-
324	N-linked_Glycosylation	PQCLNGGNCTAPSVC CCCCCCCCCCCCCEE	22.74	-
420	N-linked_Glycosylation	RSICKCRNGTCVSHK CCEEECCCCEEECCC	60.64	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of WIF1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of WIF1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of WIF1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IHOG_DROME	ihog	physical	23276604
DALY_DROME	dally	physical	23276604
HH_DROME	hh	physical	15691765

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.